CABS-dock: fb33cb35799bed1

Project name: fb33cb35799bed1

Status: done

submitted: 2026-07-28 09:49:33, status changed: 2026-07-28 11:39:01

Project settings

Protein sequence(s)	APYGARMPFGGQVPLGAPPPFPTWPGCPQPPPLHAWQAGTPPPPSPQPAAFPQSLPFPQSPAFPTASPAPPQSPGLQPLIIHHAQMVQLGLNNHMWNQRGSQAPEDKTQEAE input pdb
Peptide sequence	VQVFGDNNF
Simulation mc cycles	50
Peptide secondary structure psipred	CCCCCCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	30.9246	4.55948	22.8501	141
cluster_2.pdb ( medoid)	21.9755	5.59715	30.5673	123
cluster_3.pdb ( medoid)	13.7586	8.4311	43.0612	116
cluster_4.pdb ( medoid)	10.2093	7.15033	23.7375	73
cluster_5.pdb ( medoid)	9.73936	9.4462	31.0181	92
cluster_6.pdb ( medoid)	8.83334	13.2453	38.7336	117
cluster_7.pdb ( medoid)	7.61896	14.0439	45.1342	107
cluster_8.pdb ( medoid)	7.47623	10.9681	35.8101	82
cluster_9.pdb ( medoid)	7.30307	13.1452	42.8427	96
cluster_10.pdb ( medoid)	3.4189	15.502	42.2332	53