Project name: fb33cb35799bed1

Status: done

submitted: 2026-07-28 09:49:33, status changed: 2026-07-28 11:39:01

Project settings
Protein sequence(s) APYGARMPFGGQVPLGAPPPFPTWPGCPQPPPLHAWQAGTPPPPSPQPAAFPQSLPFPQSPAFPTASPAPPQSPGLQPLIIHHAQMVQLGLNNHMWNQRGSQAPEDKTQEAE input pdb
Peptide sequence VQVFGDNNF
Simulation mc cycles50
Peptide secondary structure psipred CCCCCCCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 30.9246 4.55948 22.8501 141
cluster_2.pdb ( medoid) 21.9755 5.59715 30.5673 123
cluster_3.pdb ( medoid) 13.7586 8.4311 43.0612 116
cluster_4.pdb ( medoid) 10.2093 7.15033 23.7375 73
cluster_5.pdb ( medoid) 9.73936 9.4462 31.0181 92
cluster_6.pdb ( medoid) 8.83334 13.2453 38.7336 117
cluster_7.pdb ( medoid) 7.61896 14.0439 45.1342 107
cluster_8.pdb ( medoid) 7.47623 10.9681 35.8101 82
cluster_9.pdb ( medoid) 7.30307 13.1452 42.8427 96
cluster_10.pdb ( medoid) 3.4189 15.502 42.2332 53