CABS-dock: 2UV0_Third

Project name: 2UV0_Third_sequence

Status: done

submitted: 2026-04-19 12:56:16, status changed: 2026-04-19 13:33:02

Project settings

Protein sequence(s)	DGFLELERSSGKLEWSAILQKMASDLGFSKILFGLLPKDSQDYENAFIVGNYPAAWREHYDRAGYARVDPTVSHCTQSVLPIFWEPSIYQTRKQHEFFEEASAAGLVYGLTMPLHGARGELGALSLSVEAENAEANRFMESVLPTLWMLKDYALQSGAGLAFE input pdb
Peptide sequence	GLLKKIKWLL
Simulation mc cycles	5
Peptide secondary structure psipred	CHHHHHHHHC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	24.3241	4.15226	9.41384	101
cluster_2.pdb ( medoid)	23.235	5.76717	14.3304	134
cluster_3.pdb ( medoid)	20.8529	5.56279	24.4847	116
cluster_4.pdb ( medoid)	18.8265	3.45257	11.6154	65
cluster_5.pdb ( medoid)	18.2302	4.93686	11.2648	90
cluster_6.pdb ( medoid)	18.1667	10.2385	28.9086	186
cluster_7.pdb ( medoid)	17.1656	3.90315	16.0095	67
cluster_8.pdb ( medoid)	9.0757	11.2388	27.7735	102
cluster_9.pdb ( medoid)	6.62329	8.45502	16.0886	56
cluster_10.pdb ( medoid)	5.59814	14.8264	32.5181	83