CABS-dock: fcfb740e58b026

Project name: fcfb740e58b026

Status: done

submitted: 2026-05-08 12:29:28, status changed: 2026-05-08 15:36:27

Project settings

Protein sequence(s)	RDDWRCARSMHEFSAKDIDGHMVNLDKYRGFVCIVTNVASQCGKTEVNYTQLVDLHARYAECGLRILAFPCNQFGKQEPGSNEEIKEFAAGYNVKFDMFSKICVNGDDAHPLWKWMKIQPKGKGILGNAIKWNFTKFLIDKNGCVVKRYGPMEEPLVIEKDLPHYF input pdb
Peptide sequence	CKFHY
Simulation mc cycles	50
Peptide secondary structure psipred	CCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	51.2578	4.35055	25.1318	223
cluster_2.pdb ( medoid)	46.3036	2.93714	8.30001	136
cluster_3.pdb ( medoid)	36.2724	2.39851	11.813	87
cluster_4.pdb ( medoid)	20.6191	6.45033	35.0184	133
cluster_5.pdb ( medoid)	14.3573	4.2487	11.3381	61
cluster_6.pdb ( medoid)	11.6013	8.44733	26.3584	98
cluster_7.pdb ( medoid)	6.66608	10.2009	27.0638	68
cluster_8.pdb ( medoid)	6.21073	5.79642	10.807	36
cluster_9.pdb ( medoid)	4.97237	16.8933	38.9217	84
cluster_10.pdb ( medoid)	4.70103	15.7412	37.0374	74