Project name: fda7616c6dde494

Status: done

submitted: 2025-12-30 18:43:24, status changed: 2025-12-30 22:08:10

Project settings
Protein sequence(s) MVLSDKTPGSASYRISDNNFVQCGSNCTMIIDGDVVRGRPQDPGAAASPARVIVQCGSNSFRMVLSDKTPGSASYRISDNNFVQCGSNCTMIIDGDVVRGRPQDPGAAASPA input pdb
Peptide sequence NPVTGRPLVNIYNCSGVQVGDNNYLTMQQT
Simulation mc cycles50
Peptide secondary structure psipred CCCCCCCEEEEECCCCCEECCCCEEEEECC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 23.1882 2.58752 23.1516 60
cluster_2.pdb ( medoid) 19.4787 6.10923 24.4216 119
cluster_3.pdb ( medoid) 15.9839 11.5116 29.4666 184
cluster_4.pdb ( medoid) 12.4004 10.7255 30.4024 133
cluster_5.pdb ( medoid) 7.1337 14.1582 40.243 101
cluster_6.pdb ( medoid) 6.94575 16.8448 42.3837 117
cluster_7.pdb ( medoid) 6.76504 12.269 24.3702 83
cluster_8.pdb ( medoid) 6.06552 11.046 29.374 67
cluster_9.pdb ( medoid) 5.79478 14.1507 28.3634 82
cluster_10.pdb ( medoid) 4.71935 11.4422 33.5028 54