CABS-dock: fdf4996e5c433e6

Project name: fdf4996e5c433e6

Status: done

submitted: 2025-05-30 09:53:42, status changed: 2025-05-30 13:38:04

Project settings

Protein sequence(s)	AQIDLNITCRFAGVFHVEKNGRYSISRTEAADLCKAFNSTLPTMAQMEKALSIGFETCRYGFIEGHVVIPRIHPNSICAANNTGVYILTSNTSQYDTYCFNASAPPEEDCTSVTDLPNAFDGPITITIVNRDGTRYVQKGEYRTNPEDIYPSNPTDDDV input pdb
Peptide sequence	KEEDKHLKFRISHEL
Simulation mc cycles	50
Peptide secondary structure psipred	CHHHHCCCCCCCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	32.1769	4.87928	27.8574	157
cluster_2.pdb ( medoid)	25.6599	6.35232	38.1418	163
cluster_3.pdb ( medoid)	17.4506	8.82492	38.5811	154
cluster_4.pdb ( medoid)	17.0121	6.52477	20.882	111
cluster_5.pdb ( medoid)	12.7335	9.97369	37.9911	127
cluster_6.pdb ( medoid)	8.78346	8.76648	38.2804	77
cluster_7.pdb ( medoid)	6.90229	6.37469	16.6687	44
cluster_8.pdb ( medoid)	6.22461	10.9244	30.2268	68
cluster_9.pdb ( medoid)	4.69643	9.58175	21.439	45
cluster_10.pdb ( medoid)	3.01034	17.9382	42.3855	54