Project name: fdfcf186007a35e

Status: done

submitted: 2025-12-27 05:53:23, status changed: 2025-12-27 18:24:49

Project settings
Protein sequence(s) HGYVSAVENGVAEGRVTLCKFAANGTGEKNTHCGAIQYEPQSVEGPDGFPVTGPRDGKIASAESALAAALDEQTADRWVKRPIQAGPQTFEWTFTANHVTKDWKYYITKPNWNPNQPLSRDAFDLNPFCVVEGNMVQPPKRVSHECIVPEREGYQVILAVWDVGDTAASFYNVIDVKFDGHGYVSAVENGVAEGRVTLCKFAANGTGEKNTHCGAIQYEPQSVEGPDGFPVTGPRDGKIASAESALAAALDEQTADRWVKRPIQAGPQTFEWTFTANHVTKDWKYYITKPNWNPNQPLSRDAFDLNPFCVVEGNMVQPPKRVSHECIVPEREGYQVILAVWDVGDTAASFYNVIDVKFDG input pdb
Peptide sequence IENRALGRLWAFSHDQAGKAVHRDR
Simulation mc cycles50
Peptide secondary structure psipred CCCCHHHHHHHCCCCCCCCHHCCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 25.2335 3.7252 23.654 94
cluster_2.pdb ( medoid) 17.5635 8.99595 26.7017 158
cluster_3.pdb ( medoid) 16.5543 8.09459 29.5695 134
cluster_4.pdb ( medoid) 10.5347 16.8016 47.3859 177
cluster_5.pdb ( medoid) 9.4189 11.3601 31.7361 107
cluster_6.pdb ( medoid) 8.13434 13.7688 48.2177 112
cluster_7.pdb ( medoid) 5.93734 9.60026 36.6674 57
cluster_8.pdb ( medoid) 5.11421 13.4918 42.3593 69
cluster_9.pdb ( medoid) 4.13201 17.909 40.2484 74
cluster_10.pdb ( medoid) 1.10879 16.2339 25.626 18