Project name: fdfda48dae8bfd6

Status: done

submitted: 2026-03-08 14:14:01, status changed: 2026-03-08 16:52:24

Project settings
Protein sequence(s) APYGARMPFGGQVPLGAPPPFPTWPGCPQPPPLHAWQAGTPPPPSPQPAAFPQSLPFPQSPAFPTASPAPPQSPGLQPLIIHHAQMVQLGLNNHMWNQRGSQAPEDKTQEAE input pdb
Peptide sequence VQVFGDNNY
Simulation mc cycles50
Peptide secondary structure psipred CCCCCCCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 23.1268 5.70765 22.1614 132
cluster_2.pdb ( medoid) 22.3443 6.48936 33.506 145
cluster_3.pdb ( medoid) 11.5227 11.8896 29.0992 137
cluster_4.pdb ( medoid) 11.3244 8.74215 27.1974 99
cluster_5.pdb ( medoid) 8.71885 10.6665 23.0501 93
cluster_6.pdb ( medoid) 8.53497 12.8882 27.2059 110
cluster_7.pdb ( medoid) 7.78559 10.5323 23.1371 82
cluster_8.pdb ( medoid) 7.53285 9.69089 26.1941 73
cluster_9.pdb ( medoid) 5.65629 11.4916 36.2273 65
cluster_10.pdb ( medoid) 5.37361 11.9101 24.3621 64