Project name: JSLEE_19

Status: done

submitted: 2023-11-27 09:45:13, status changed: 2023-11-27 11:18:32

Project settings
Protein sequence(s) SRRNAWGNQSYAELISQAIESAPEKRLTLAQIYEWMVRTVPYFKDKGDSNSSAGWKNSIRHNLSLHSKFIKVHNEATGKSSWWMLNPEGG input pdb
Peptide sequence DLMLSPDDIEQWFTED
Simulation mc cycles50
Peptide secondary structure CCCCCCCCCCCCCCCC
Contact information
126:A 12:PEP 6.0 1.0
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 25.6152 3.4745 11.5107 89
cluster_2.pdb ( medoid) 25.1793 5.99698 12.5495 151
cluster_3.pdb ( medoid) 21.2287 4.19244 12.357 89
cluster_4.pdb ( medoid) 19.8171 8.7803 31.2346 174
cluster_5.pdb ( medoid) 18.5799 8.12706 18.6875 151
cluster_6.pdb ( medoid) 16.6904 7.78889 18.5062 130
cluster_7.pdb ( medoid) 13.5263 4.80545 15.0977 65
cluster_8.pdb ( medoid) 7.8954 8.23264 15.5946 65
cluster_9.pdb ( medoid) 4.83256 8.89797 20.6323 43
cluster_10.pdb ( medoid) 4.791 8.97516 15.6442 43