CABS-dock: LexA-Cs6

Project name: LexA-Cs6

Status: done

submitted: 2026-01-10 14:50:25, status changed: 2026-01-10 18:05:43

Project settings

Protein sequence(s)	EEEEGLPLVGRVAAGEPLLAQQHIEGHYQVDPSLFKPNADFLLRVSGMSMKDIGIMDGDLLAVHKTQDVRNGQVVVARIDDEVTVKRLKKQGNKVELLPENSEFKPIVVDLRQQSFTIEGLAVGVVIRNGDWL input pdb
Peptide sequence	QAIIHNEKVQAHGKKVL
Simulation mc cycles	50
Peptide secondary structure psipred	CCCCCCHHHHHCCCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	47.9168	2.1913	21.6621	105
cluster_2.pdb ( medoid)	28.1219	2.6314	16.3454	74
cluster_3.pdb ( medoid)	13.6142	8.6674	27.5494	118
cluster_4.pdb ( medoid)	12.8786	12.1907	34.544	157
cluster_5.pdb ( medoid)	11.7727	11.6371	35.9243	137
cluster_6.pdb ( medoid)	10.2572	11.9916	35.8418	123
cluster_7.pdb ( medoid)	7.94988	11.1951	27.1723	89
cluster_8.pdb ( medoid)	7.00851	9.41713	28.2581	66
cluster_9.pdb ( medoid)	6.52026	11.8093	35.3408	77
cluster_10.pdb ( medoid)	5.1444	10.4969	33.7803	54