CABS-dock: fe94fa528f9f8d4

Project name: fe94fa528f9f8d4

Status: done

submitted: 2026-03-16 10:25:16, status changed: 2026-03-16 12:23:34

Project settings

Protein sequence(s)	APYGARMPFGGQVPLGAPPPFPTWPGCPQPPPLHAWQAGTPPPPSPQPAAFPQSLPFPQSPAFPTASPAPPQSPGLQPLIIHHAQMVQLGLNNHMWNQRGSQAPEDKTQEAE input pdb
Peptide sequence	RRRVQLFGSNDARRR
Simulation mc cycles	50
Peptide secondary structure psipred	CCCCCCCCCCCCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	20.2968	6.50348	28.2966	132
cluster_2.pdb ( medoid)	17.8691	8.61821	32.5814	154
cluster_3.pdb ( medoid)	10.7424	10.2398	28.6132	110
cluster_4.pdb ( medoid)	10.5855	8.50219	22.4686	90
cluster_5.pdb ( medoid)	8.93368	13.7681	32.0574	123
cluster_6.pdb ( medoid)	8.78274	12.6384	30.7604	111
cluster_7.pdb ( medoid)	8.29321	13.1433	28.5627	109
cluster_8.pdb ( medoid)	6.51715	11.9684	29.9337	78
cluster_9.pdb ( medoid)	4.45462	10.3264	21.1189	46
cluster_10.pdb ( medoid)	3.41462	13.7644	25.7329	47