Project name: ff9d37002f7e372

Status: done

submitted: 2025-12-29 07:06:33, status changed: 2025-12-30 06:57:13

Project settings
Protein sequence(s) PVLDQLTDPPGVRRVYHIQAGLPDPFQPPSLPITVYYAVLERACRSVLLNAPSEAPQIVRGASEDVRKQPYNLTIAWFRMGGNCAIPITVMEYTECSYNKSLGACPIRTQPRWNYYDSFSAVSEDNLGFLMHAPAFETAGTYLRLVKINDWTEITQFILEHRAKGSCKYALPLRIPPSACLSPQAYQQGVTVDSIGMLPRFIPENQRTVAVYSLKIAGWHGPKAPYTSTLLPPELAPEDPEDSALLEDPVGTVAPQIPPNWHIPSIQDAATPYCPVLDQLTDPPGVRRVYHIQAGLPDPFQPPSLPITVYYAVLERACRSVLLNAPSEAPQIVRGASEDVRKQPYNLTIAWFRMGGNCAIPITVMEYTECSYNKSLGACPIRTQPRWNYYDSFSAVSEDNLGFLMHAPAFETAGTYLRLVKINDWTEITQFILEHRAKGSCKYALPLRIPPSACLSPQAYQQGVTVDSIGMLPRFIPENQRTVAVYSLKIAGWHGPKAPYTSTLLPPELAPEDPEDSALLEDPVGTVAPQIPPNWHIPSIQDAATPYC input pdb
Peptide sequence GNPKVAHCAS
Simulation mc cycles50
Peptide secondary structure psipred CCCCCCCCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 27.6493 3.8699 49.9052 107
cluster_2.pdb ( medoid) 20.0398 10.6788 42.7066 214
cluster_3.pdb ( medoid) 16.0107 8.11959 37.6667 130
cluster_4.pdb ( medoid) 11.4061 9.90695 34.2252 113
cluster_5.pdb ( medoid) 10.2775 9.73 39.2513 100
cluster_6.pdb ( medoid) 10.1788 9.72606 34.6357 99
cluster_7.pdb ( medoid) 9.9801 11.8235 34.9016 118
cluster_8.pdb ( medoid) 3.62646 20.6813 42.1223 75
cluster_9.pdb ( medoid) 2.12502 18.3528 47.9354 39
cluster_10.pdb ( medoid) 0.450136 11.1078 19.7955 5