Project name: 2x04_modified_chains-AC.pdb_stat_DIBS

Status: done

submitted: 2018-04-18 14:35:35, status changed: 2018-04-20 14:15:38
Settings
Chain sequence(s) A: GPLGSLTASSMLASAPPQEQKQMLGERLFPLIQAMHPTLAGKITGMLLEIDNSELLHMLESPESSLRSSKVDEAVAVLQA
C: WPPEFHPGVPWKGLQ
Distance of aggregation 10 Å
Dynamic mode No
Show buried residues

Minimal score value
-3.3317
Maximal score value
1.0116
Average score
-0.8111
Total score value
-74.6238

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
540 G A -0.2768
541 P A 0.1021
542 L A 0.9797
543 G A 0.0778
544 S A -0.0241
545 L A 0.0415
546 T A 0.0271
547 A A -0.0752
548 S A -0.0047
549 M A 0.2857
550 L A 0.0000
551 A A -0.2397
552 S A -0.3061
553 A A -0.6360
554 P A -1.1181
555 P A -1.2524
556 Q A -1.9904
557 E A -1.8900
558 Q A -1.0671
559 K A -1.4878
560 Q A -1.3092
561 M A -0.3945
562 L A 0.0000
563 G A 0.0000
564 E A -0.2936
565 R A 0.0182
566 L A 0.0000
567 F A 0.0000
568 P A -0.1682
569 L A 0.2628
570 I A 0.0000
571 Q A -0.6113
572 A A -0.1295
573 M A -0.4776
574 H A -0.4505
575 P A -0.5536
576 T A -0.4271
577 L A -0.5062
578 A A 0.0000
579 G A -1.6309
580 K A -1.4229
581 I A 0.0000
582 T A 0.0000
583 G A 0.0000
584 M A -0.8067
585 L A 0.0000
586 L A 0.0000
587 E A -1.9920
588 I A -1.6755
589 D A -2.5550
590 N A -1.9085
591 S A -1.5564
592 E A -2.3466
593 L A 0.0000
594 L A 0.0000
595 H A -1.9468
596 M A 0.0000
597 L A -1.2559
598 E A -2.4026
599 S A -2.0323
600 P A -2.0913
601 E A -2.8897
602 S A -2.2732
603 L A 0.0000
604 R A -3.3317
605 S A -2.7563
606 K A -2.3743
607 V A 0.0000
608 D A -2.9127
609 E A -2.6334
610 A A 0.0000
611 V A -0.7491
612 A A -0.3992
613 V A 1.0116
614 L A 0.2577
615 Q A -0.5179
616 A A 0.2156
1385 W C 0.4913
1386 P C -0.5176
1387 P C -1.4355
1388 E C -2.5140
1389 F C 0.0000
1390 H C -1.7741
1391 P C -0.7809
1392 G C -0.5331
1393 V C -0.2204
1394 P C -1.0930
1395 W C 0.0000
1396 K C -2.3369
1397 G C -1.6462
1398 L C -1.4255
1399 Q C -1.9671

 

Laboratory of Theory of Biopolymers 2015