Project name: 2vwf

Chain sequence(s)	A: TYVQALFDFDPQEDGELGFRRGDFIHVMDNSDPNWWKGACCHGQTGMFPRNYVTAVN; B: IQPPPVNRNLKPDR
Distance of aggregation	10 Å
Dynamic mode	No

• Minimal score value: -3.3997
• Maximal score value: 1.4181
• Average score: -0.9182
• Total score value: -64.2755

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
1	T	A	0.1668
2	Y	A	1.0091
3	V	A	0.0000
4	Q	A	-0.1171
5	A	A	0.0000
6	L	A	-0.9298
7	F	A	-1.7809
8	D	A	-2.9890
9	F	A	0.0000
10	D	A	-2.7730
11	P	A	-2.2892
12	Q	A	-2.4256
13	E	A	-2.4144
14	D	A	-2.5484
15	G	A	-2.0771
16	E	A	0.0000
17	L	A	0.0000
18	G	A	-1.8839
19	F	A	0.0000
20	R	A	-3.3997
21	R	A	-2.9489
22	G	A	-1.4980
23	D	A	-1.0483
24	F	A	0.8347
25	I	A	0.0000
26	H	A	0.0968
27	V	A	0.0000
28	M	A	0.3918
29	D	A	-0.7831
30	N	A	-1.4538
31	S	A	-0.9882
32	D	A	-1.1324
33	P	A	-1.1264
34	N	A	-1.4028
35	W	A	0.0000
36	W	A	-1.1715
37	K	A	-0.8189
38	G	A	0.0000
39	A	A	-0.5692
40	C	A	0.0000
41	H	A	-1.5219
42	G	A	-1.5593
43	Q	A	-1.8331
44	T	A	-1.0068
45	G	A	-0.8410
46	M	A	0.0000
47	F	A	0.0000
48	P	A	0.0000
49	R	A	-2.1958
50	N	A	-1.8558
51	Y	A	0.0000
52	V	A	0.0000
53	T	A	-0.0516
54	A	A	0.2160
55	V	A	0.2511
56	N	A	-0.9087
1	I	B	1.4181
2	Q	B	-0.2326
3	P	B	-0.4872
4	P	B	-0.5557
5	P	B	-0.7305
6	V	B	-0.6363
7	N	B	-1.4819
8	R	B	-1.7680
9	N	B	-1.9325
10	L	B	-0.9907
11	K	B	0.0000
12	P	B	-1.8101
13	D	B	-2.8261
14	R	B	-2.8647