Project name: moe-use-symmetrical

Status: done

submitted: 2019-10-02 09:02:32, status changed: 2019-10-02 09:10:53
Settings
Chain sequence(s) A: PIKLRVEKAYPEDVGKRAVRMDKASRDRIGVSEGDLVKITGSKTPIKLRVEKAYPEDVGKRAVRMDKASRDRIGVSEGDLVKITG
Distance of aggregation 10 Å
Dynamic mode No
Show buried residues

Minimal score value
-3.5712
Maximal score value
0.0
Average score
-1.547
Total score value
-131.4938

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 P A -0.9508
2 I A -1.0149
3 K A -1.6841
4 L A 0.0000
5 R A -3.0686
6 V A 0.0000
7 E A -3.0731
8 K A -2.7557
9 A A -1.5665
10 Y A -0.4103
11 P A -0.5920
12 E A -1.0991
13 D A 0.0000
14 V A -0.6832
15 G A -1.3578
16 K A -2.2541
17 R A -2.9166
18 A A -2.4906
19 V A 0.0000
20 R A -1.5968
21 M A 0.0000
22 D A 0.0000
23 K A -3.0718
24 A A -2.2986
25 S A 0.0000
26 R A -3.0078
27 D A -3.4005
28 R A -3.0686
29 I A -1.6416
30 G A -1.9828
31 V A -1.8983
32 S A -2.2477
33 E A -2.9945
34 G A -2.1163
35 D A -2.0050
36 L A -1.5439
37 V A 0.0000
38 K A -1.9647
39 I A 0.0000
40 T A -1.5827
41 G A -1.4857
42 S A -1.2847
43 K A -2.3455
44 T A -1.7632
45 P A -1.5683
46 I A -1.7841
47 K A -2.6297
48 L A 0.0000
49 R A -3.4136
50 V A 0.0000
51 E A -3.0852
52 K A -2.5649
53 A A 0.0000
54 Y A -0.3436
55 P A -0.6608
56 E A -1.4024
57 D A 0.0000
58 V A -0.6579
59 G A -1.3385
60 K A -2.1482
61 R A -2.6985
62 A A -2.3106
63 V A 0.0000
64 R A -1.7590
65 M A 0.0000
66 D A 0.0000
67 K A -3.0656
68 A A -2.3309
69 S A 0.0000
70 R A -3.1297
71 D A -3.5712
72 R A -3.4571
73 I A 0.0000
74 G A -2.3569
75 V A -2.0243
76 S A -2.0908
77 E A -2.6985
78 G A -2.0751
79 D A -1.9266
80 L A -1.3553
81 V A 0.0000
82 K A -1.3078
83 I A 0.0000
84 T A -1.2101
85 G A -1.3105

 

Laboratory of Theory of Biopolymers 2015