Project name: 2a3076f97752840 [mutate: VA3E] [mutate: DA2K]

Status: done

submitted: 2018-01-12 16:13:11, status changed: 2018-01-12 16:18:05
Settings
Chain sequence(s) A: IDELLGADDGSLAFVPSEFSISPGEKIVFKNNAGFPHNIVFDEDSIPSGVDASKISMSEEDLLNAKGETFEVALSNKGEYSFYCSPHQGAGMVGKVTVN
Distance of aggregation 10 Å
Dynamic mode No
Mutated residues DA2K
Energy difference between WT (input) and mutated protein (by FoldX) -1.55452 kcal/mol
Show buried residues

Minimal score value
-3.2238
Maximal score value
0.1373
Average score
-1.1514
Total score value
-113.9898

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 I A -0.4421
2 K A -1.5042 mutated: DA2K
3 E A 0.0000
4 L A -0.3750
5 L A 0.0000
6 G A 0.0000
7 A A -1.3441
8 D A -2.6896
9 D A -2.8697
10 G A -1.8102
11 S A -0.9368
12 L A -0.1010
13 A A 0.1373
14 F A 0.0000
15 V A -0.0110
16 P A -0.3957
17 S A -0.7020
18 E A -1.9292
19 F A -0.8007
20 S A -1.0992
21 I A 0.0000
22 S A -1.6528
23 P A -1.8304
24 G A -1.3909
25 E A -1.6077
26 K A -2.2684
27 I A 0.0000
28 V A -1.4506
29 F A 0.0000
30 K A -1.5785
31 N A 0.0000
32 N A -1.3767
33 A A -1.2212
34 G A -0.8347
35 F A -0.2491
36 P A -0.5533
37 H A 0.0000
38 N A 0.0000
39 I A 0.0000
40 V A 0.0000
41 F A 0.0000
42 D A -2.1095
43 E A -3.2137
44 D A -2.9187
45 S A -2.1443
46 I A -2.1146
47 P A -1.7644
48 S A -1.2780
49 G A -0.8426
50 V A -1.3350
51 D A -2.0600
52 A A -2.0724
53 S A -1.6387
54 K A -2.1066
55 I A 0.0000
56 S A -1.4869
57 M A -1.1280
58 S A -1.8654
59 E A -2.9623
60 E A -3.1127
61 D A -2.3523
62 L A -0.8328
63 L A 0.0000
64 N A -1.5835
65 A A -1.6439
66 K A -2.4705
67 G A -1.9093
68 E A -1.7086
69 T A -1.4316
70 F A -0.8694
71 E A -2.0895
72 V A 0.0000
73 A A -1.6653
74 L A 0.0000
75 S A -1.8253
76 N A -2.6974
77 K A -3.2238
78 G A -2.3817
79 E A -2.5419
80 Y A 0.0000
81 S A -1.4997
82 F A 0.0000
83 Y A -0.3469
84 C A 0.0000
85 S A -1.1888
86 P A -0.9107
87 H A -0.6236
88 Q A -1.0262
89 G A -0.9647
90 A A -0.5399
91 G A -0.5345
92 M A 0.0000
93 V A 0.0651
94 G A 0.0000
95 K A -1.7082
96 V A 0.0000
97 T A -2.0619
98 V A 0.0000
99 N A -2.3817

 

Laboratory of Theory of Biopolymers 2015