Project name: 448c4f372341d8

Status: done

submitted: 2019-10-11 16:43:09, status changed: 2019-10-11 16:50:54
Settings
Chain sequence(s) A: MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVDDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV
Distance of aggregation 10 Å
Dynamic mode No
Show buried residues

Minimal score value
-3.7825
Maximal score value
0.6326
Average score
-1.1797
Total score value
-123.8651

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 M A -0.1570
2 V A 0.0000
3 K A -1.8991
4 Q A -2.3011
5 I A 0.0000
6 E A -2.9494
7 S A -2.4711
8 K A -2.4118
9 T A -1.5898
10 A A -2.0068
11 F A 0.0000
12 Q A -2.7494
13 E A -3.0778
14 A A -2.0361
15 L A -2.5776
16 D A -3.3885
17 A A -1.9622
18 A A 0.0000
19 G A -2.2829
20 D A -2.8974
21 K A -1.5948
22 L A 0.0000
23 V A 0.0000
24 V A 0.0000
25 V A 0.0000
26 D A 0.0000
27 F A 0.0000
28 S A -0.5361
29 A A 0.0000
30 T A -0.2399
31 W A 0.6326
32 C A 0.2124
33 G A -0.5232
34 P A -0.6254
35 C A 0.0000
36 K A -1.4954
37 M A -0.2887
38 I A 0.0000
39 K A -1.0394
40 P A -0.6029
41 F A -0.3019
42 F A 0.0000
43 H A -1.0167
44 S A -1.1249
45 L A 0.0000
46 S A 0.0000
47 E A -2.5838
48 K A -2.6515
49 Y A -1.4813
50 S A -1.4013
51 N A -1.6347
52 V A 0.0000
53 I A 0.0688
54 F A 0.0000
55 L A 0.0000
56 E A -1.3997
57 V A 0.0000
58 D A -2.2565
59 V A 0.0000
60 D A -3.2396
61 D A -3.7825
62 C A 0.0000
63 Q A -3.5276
64 D A -3.6032
65 V A 0.0000
66 A A 0.0000
67 S A -2.8488
68 E A -3.1629
69 C A -2.3948
70 E A -2.9655
71 V A 0.0000
72 K A -1.8162
73 C A -0.2599
74 M A 0.0826
75 P A 0.0000
76 T A 0.0000
77 F A 0.0000
78 Q A 0.0000
79 F A 0.0000
80 F A 0.0000
81 K A -2.3969
82 K A -3.5621
83 G A -2.9589
84 Q A -2.4014
85 K A -2.0195
86 V A -0.7576
87 G A -0.8850
88 E A -1.5158
89 F A -0.7916
90 S A -0.5677
91 G A -0.5387
92 A A -1.2532
93 N A -2.3295
94 K A -2.5343
95 E A -3.1194
96 K A -2.7004
97 L A 0.0000
98 E A -2.0432
99 A A -1.9923
100 T A 0.0000
101 I A 0.0000
102 N A -1.6983
103 E A -1.8815
104 L A -0.2161
105 V A 0.4590

 

Laboratory of Theory of Biopolymers 2015