Project name: 4840f9efbcb93ac [mutate: VA23A]

Status: done

submitted: 2018-01-12 16:01:46, status changed: 2018-01-12 16:06:38
Settings
Chain sequence(s) A: KELVLALYDYQEKSPREVTMKKGDILTLLNSTNKDWWKVEVNDRQGFVPAAYVKKLD
Distance of aggregation 10 Å
Dynamic mode No
Mutated residues VA23A
Energy difference between WT (input) and mutated protein (by FoldX) 2.04275 kcal/mol
Show buried residues

Minimal score value
-3.4796
Maximal score value
0.934
Average score
-1.2662
Total score value
-72.1716

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
6 K A -2.1785
7 E A -2.0628
8 L A -0.4266
9 V A 0.0000
10 L A 0.1535
11 A A 0.0000
12 L A -0.2809
13 Y A -0.7397
14 D A -2.5841
15 Y A 0.0000
16 Q A -2.3560
17 E A -2.2509
18 K A -2.5146
19 S A -1.6575
20 P A -1.3035
21 R A -1.8260
22 E A 0.0000
23 A A 0.0000 mutated: VA23A
24 T A -1.8417
25 M A 0.0000
26 K A -3.0249
27 K A -2.5344
28 G A -1.3551
29 D A -0.9509
30 I A 0.9340
31 L A 0.0000
32 T A -0.7330
33 L A 0.0000
34 L A -0.8179
35 N A -1.0904
36 S A -1.4291
37 T A -1.5864
38 N A -2.8393
39 K A -3.1620
40 D A -2.8137
41 W A -1.5151
42 W A -1.0402
43 K A -1.1120
44 V A 0.0000
45 E A -1.9649
46 V A -2.1543
47 N A -2.6222
48 D A -3.4796
49 R A -3.3953
50 Q A -2.8415
51 G A 0.0000
52 F A -0.7775
53 V A 0.0000
54 P A -0.5866
55 A A -1.2606
56 A A -0.3168
57 Y A 0.1279
58 V A 0.0000
59 K A -1.3142
60 K A -1.6058
61 L A -0.8134
62 D A -2.2271

 

Laboratory of Theory of Biopolymers 2015