Project name: stat_full_ser [mutate: CA377S, CA387S, CA406S, CA416S]

Chain sequence(s)	A: NSVGEACTDMKREYDQCFNRWFAEKFLKGDSSGDPCTDLFKRYQQCVQKAI
Distance of aggregation	10 Å
Dynamic mode	No
Mutated residues	CA377S, CA387S, CA406S, CA416S
Energy difference between WT (input) and mutated protein (by FoldX)	7.46654 kcal/mol CAUTION: Your mutation/s can destabilize the protein structure Changes in protein stability upon mutation are calculated using the FoldX forcefield. Computational prediction of protein stability is used with the intention of preventing the experimental characterization of proteins bearing mutations that significantly destabilize their structure. Mutations resulting in a predicted reduction in protein stability ≥ 1 kcal/mol are considered disruptive.

• Minimal score value: -3.8197
• Maximal score value: 1.0975
• Average score: -1.8915
• Total score value: -96.4689

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
371	N	A	-1.5609
372	S	A	-0.8722
373	V	A	-0.1417
374	G	A	-1.1961
375	E	A	-2.4383
376	A	A	-1.4878
377	S	A	-2.2056	mutated: CA377S
378	T	A	-2.3645
379	D	A	-3.3684
380	M	A	-2.7936
381	K	A	-3.1963
382	R	A	-3.8197
383	E	A	-3.6442
384	Y	A	-2.9042
385	D	A	-2.8150
386	Q	A	-3.2885
387	S	A	-2.1988	mutated: CA387S
388	F	A	-1.8100
389	N	A	-2.6707
390	R	A	-3.0646
391	W	A	0.0000
392	F	A	-0.9656
393	A	A	-1.2665
394	E	A	-2.9511
395	K	A	-2.6879
396	F	A	-0.5885
397	L	A	0.2504
398	K	A	-2.1157
399	G	A	-1.7664
400	D	A	-2.6644
401	S	A	-1.6333
402	S	A	-1.1684
403	G	A	-1.3597
404	D	A	-1.4730
405	P	A	-1.1490
406	S	A	0.0000	mutated: CA406S
407	T	A	-1.5528
408	D	A	-2.7190
409	L	A	-2.0586
410	F	A	-1.9515
411	K	A	-3.2966
412	R	A	-3.4138
413	Y	A	-2.9092
414	Q	A	-2.7764
415	Q	A	-2.9924
416	S	A	0.0000	mutated: CA416S
417	V	A	-0.9660
418	Q	A	-1.8485
419	K	A	-1.7156
420	A	A	0.0142
421	I	A	1.0975