Project name: IFNG chainA T27A-2 [mutate: TA27A]

Chain sequence(s)	A: MQDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQSQIVSFYFKLFKNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTNYSVTDLNVQRKAIHELIQVMAELSPAAKT
Distance of aggregation	10 Å
Dynamic mode	No
Mutated residues	TA27A
Energy difference between WT (input) and mutated protein (by FoldX)	0.0881154 kcal/mol Changes in protein stability upon mutation are calculated using the FoldX forcefield. Computational prediction of protein stability is used with the intention of preventing the experimental characterization of proteins bearing mutations that significantly destabilize their structure. Mutations resulting in a predicted reduction in protein stability ≥ 1 kcal/mol are considered disruptive.

• Minimal score value: -4.8011
• Maximal score value: 1.9159
• Average score: -1.3382
• Total score value: -169.9513

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
0	M	A	0.0676
1	Q	A	-1.5384
2	D	A	-1.9031
3	P	A	-1.2283
4	Y	A	-1.4569
5	V	A	-1.5366
6	K	A	-2.6445
7	E	A	0.0000
8	A	A	-1.8136
9	E	A	-3.2641
10	N	A	-2.5376
11	L	A	0.0000
12	K	A	-3.3565
13	K	A	-3.0776
14	Y	A	-0.9210
15	F	A	-0.8117
16	N	A	-1.9078
17	A	A	-1.6122
18	G	A	-2.0946
19	H	A	-1.9254
20	S	A	-1.5419
21	D	A	-2.1044
22	V	A	-0.5027
23	A	A	-1.2158
24	D	A	-2.5348
25	N	A	-2.0787
26	G	A	-0.7995
27	A	A	0.7569	mutated: TA27A
28	L	A	1.9159
29	F	A	1.4960
30	L	A	1.5769
31	G	A	0.4077
32	I	A	0.5810
33	L	A	-0.2598
34	K	A	-1.9011
35	N	A	-2.1819
36	W	A	-2.4920
37	K	A	-3.9132
38	E	A	-4.0749
39	E	A	-3.6064
40	S	A	-2.1615
41	D	A	-2.0414
42	R	A	-2.5525
43	K	A	-1.5792
44	I	A	0.6531
45	M	A	0.1071
46	Q	A	-0.6638
47	S	A	-0.4442
48	Q	A	-0.7993
49	I	A	0.0000
50	V	A	0.0000
51	S	A	-0.5469
52	F	A	-0.2420
53	Y	A	-0.1942
54	F	A	-1.0800
55	K	A	-1.9897
56	L	A	-1.0633
57	F	A	0.0000
58	K	A	-3.1110
59	N	A	-2.8232
60	F	A	-2.4129
61	K	A	-3.1930
62	D	A	-3.3062
63	D	A	-2.7061
64	Q	A	-2.5832
65	S	A	-1.5221
66	I	A	0.0000
67	Q	A	-2.4655
68	K	A	-2.6214
69	S	A	0.0000
70	V	A	0.0000
71	E	A	-3.1163
72	T	A	-2.1615
73	I	A	-1.5202
74	K	A	-2.1808
75	E	A	-2.5379
76	D	A	-1.7563
77	M	A	-1.2704
78	N	A	-1.9833
79	V	A	-1.2294
80	K	A	-1.9802
81	F	A	-1.5673
82	F	A	0.0000
83	N	A	-2.3635
84	S	A	-2.3788
85	N	A	-3.5420
86	K	A	-4.2352
87	K	A	-4.6217
88	K	A	-4.8011
89	R	A	-4.2043
90	D	A	-4.2907
91	D	A	-3.2897
92	F	A	-2.2590
93	E	A	-2.7556
94	K	A	-2.3855
95	L	A	-0.0060
96	T	A	-0.9108
97	N	A	-0.7356
98	Y	A	0.8557
99	S	A	0.9192
100	V	A	1.6435
101	T	A	0.7167
102	D	A	-0.1040
103	L	A	0.1827
104	N	A	-1.1045
105	V	A	-0.6971
106	Q	A	-1.0860
107	R	A	-2.7536
108	K	A	-2.8718
109	A	A	-1.1257
110	I	A	-0.0553
111	H	A	-1.6617
112	E	A	-1.6222
113	L	A	0.6629
114	I	A	1.5780
115	Q	A	-0.2269
116	V	A	0.6282
117	M	A	1.3595
118	A	A	0.2309
119	E	A	-0.6465
120	L	A	0.8134
121	S	A	0.1123
122	P	A	-0.2585
123	A	A	-0.5717
124	A	A	-0.8361
125	K	A	-1.6930
126	T	A	-0.8792