Project name: mut random [mutate: NA33K]

Chain sequence(s)	A: AEGYQYRALYDYKKEREEDIDLHLGDILTVNKGSLVALGFSDGQEARPEEIGWLNGYNETTGERGDFPGTYVEYIGRKKISPP
Distance of aggregation	10 Å
Dynamic mode	No
Mutated residues	NA33K
Energy difference between WT (input) and mutated protein (by FoldX)	0.00202604 kcal/mol Changes in protein stability upon mutation are calculated using the FoldX forcefield. Computational prediction of protein stability is used with the intention of preventing the experimental characterization of proteins bearing mutations that significantly destabilize their structure. Mutations resulting in a predicted reduction in protein stability ≥ 1 kcal/mol are considered disruptive.

• Minimal score value: -3.9236
• Maximal score value: 1.979
• Average score: -1.029
• Total score value: -85.4046

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
3	A	A	-1.1918
4	E	A	-2.5949
5	G	A	0.0000
6	Y	A	0.0000
7	Q	A	0.0000
8	Y	A	0.0000
9	R	A	-1.0106
10	A	A	0.0000
11	L	A	0.7466
12	Y	A	1.1355
13	D	A	-1.1551
14	Y	A	-1.6194
15	K	A	-3.2325
16	K	A	-3.8934
17	E	A	-3.9236
18	R	A	-3.8855
19	E	A	-3.8646
20	E	A	-3.8582
21	D	A	0.0000
22	I	A	0.0000
23	D	A	-2.4989
24	L	A	0.0000
25	H	A	-0.5040
26	L	A	1.2239
27	G	A	0.3391
28	D	A	0.0000
29	I	A	-0.4982
30	L	A	0.0000
31	T	A	0.0000
32	V	A	0.0000
33	K	A	-2.1817	mutated: NA33K
34	K	A	-2.0066
35	G	A	-0.7710
36	S	A	-0.2680
37	L	A	0.0000
38	V	A	1.5436
39	A	A	1.2666
40	L	A	1.9790
41	G	A	0.8033
42	F	A	0.4005
43	S	A	-0.5700
44	D	A	-2.1349
45	G	A	-1.7152
46	Q	A	-2.2468
47	E	A	-2.0996
48	A	A	-1.9908
49	R	A	-3.4756
50	P	A	0.0000
51	E	A	-3.3102
52	E	A	-3.2270
53	I	A	-1.4916
54	G	A	-1.0307
55	W	A	-0.0322
56	L	A	0.0000
57	N	A	-1.0183
58	G	A	0.0000
59	Y	A	-1.1168
60	N	A	0.0000
61	E	A	-2.3005
62	T	A	-1.2292
63	T	A	-1.5751
64	G	A	-2.1384
65	E	A	-3.0603
66	R	A	-3.0499
67	G	A	0.0000
68	D	A	-1.9380
69	F	A	0.0000
70	P	A	0.0000
71	G	A	0.0000
72	T	A	-1.1143
73	Y	A	-0.0010
74	V	A	0.0000
75	E	A	-2.0625
76	Y	A	-1.0045
77	I	A	0.4888
78	G	A	-0.7288
79	R	A	-2.6602
80	K	A	-2.8777
81	K	A	-2.6194
82	I	A	-1.1902
83	S	A	-0.6905
84	P	A	-0.3233
85	P	A	-0.3500