Project name: HC-G178P [mutate: GH178P]

Status: done

submitted: 2018-01-12 21:11:42, status changed: 2018-01-12 21:21:02
Settings
Chain sequence(s) H: EVQLVESGGGLVQPGGSLRLSCAASGFAFSTYDMSWVRQAPGKGLEWVATISSGGSYTYYLDSVKGRFTISRDSSKNTLYLQMNSLRAEDTAVYYCAPTTVVPFAYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTSAA
L: DIQMTQSPSSLSASVGDRVTITCKASQNVRTVVAWYQQKPGKAPKTLIYLASNRHTGVPSRFSGSGSGTDFTLTISSLQPEDFATYFCLQHWSYPLTFGQGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
Distance of aggregation 10 Å
Dynamic mode No
Mutated residues GH178P
Energy difference between WT (input) and mutated protein (by FoldX) 6.77124 kcal/mol
Show buried residues

Minimal score value
-3.7177
Maximal score value
1.3012
Average score
-0.7211
Total score value
-318.727

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 D L -2.4047
2 I L 0.0000
3 Q L -2.0435
4 M L 0.0000
5 T L -1.1056
6 Q L 0.0000
7 S L -0.6023
8 P L -0.5589
9 S L -0.8399
10 S L -0.7074
11 L L -0.4816
12 S L -0.8713
13 A L 0.0000
14 S L -0.5234
15 V L 0.4442
16 G L -0.5836
17 D L -1.5498
18 R L -2.2395
19 V L 0.0000
20 T L -0.5906
21 I L 0.0000
22 T L -0.7518
23 C L 0.0000
24 K L -2.1071
25 A L -1.9775
26 S L -2.0858
27 Q L -2.6921
28 N L -2.7267
29 V L 0.0000
30 R L -2.5176
31 T L -1.2505
32 V L 0.0000
33 V L 0.0000
34 A L 0.0000
35 W L 0.0000
36 Y L 0.0000
37 Q L 0.0000
38 Q L -1.3609
39 K L -1.9152
40 P L -1.8054
41 G L -1.5559
42 K L -2.5372
43 A L -1.7566
44 P L 0.0000
45 K L -1.7358
46 T L 0.0000
47 L L 0.0000
48 I L 0.0000
49 Y L -0.0023
50 L L 0.0482
51 A L 0.0000
52 S L -0.9381
53 N L -1.3624
54 R L -2.2482
55 H L 0.0000
56 T L -1.1816
57 G L -1.3246
58 V L 0.0000
59 P L -0.7481
60 S L -0.8810
61 R L -1.0623
62 F L 0.0000
63 S L -0.9274
64 G L 0.0000
65 S L -0.6697
66 G L -1.2644
67 S L -1.7114
68 G L -2.2651
69 T L -2.3564
70 D L -2.6667
71 F L 0.0000
72 T L -0.7465
73 L L 0.0000
74 T L -0.6244
75 I L 0.0000
76 S L -1.2979
77 S L -1.0831
78 L L 0.0000
79 Q L -0.9910
80 P L -0.9771
81 E L -1.9898
82 D L 0.0000
83 F L -0.6380
84 A L 0.0000
85 T L -0.9062
86 Y L 0.0000
87 F L 0.0000
88 C L 0.0000
89 L L 0.0000
90 Q L 0.0000
91 H L 0.4095
92 W L 0.1087
93 S L 0.0428
94 Y L 0.2526
95 P L -0.3376
96 L L 0.0000
97 T L -0.7084
98 F L 0.0000
99 G L 0.0000
100 Q L -1.5518
101 G L 0.0000
102 T L 0.0000
103 K L -1.5679
104 V L 0.0000
105 E L 0.0000
106 I L -0.5692
107 K L -1.4288
108 R L -1.3012
109 T L -0.2490
110 V L 0.1517
111 A L -0.1236
112 A L -0.2554
113 P L 0.0000
114 S L -0.1716
115 V L 0.0000
116 F L 0.2573
117 I L 0.1100
118 F L 0.0000
119 P L -0.6988
120 P L 0.0000
121 S L -1.3436
122 D L -2.6369
123 E L -2.1529
124 Q L 0.0000
125 L L -1.8275
126 K L -2.5607
127 S L -1.5637
128 G L -1.3770
129 T L -1.1228
130 A L 0.0000
131 S L 0.0000
132 V L 0.0000
133 V L 0.0000
134 C L 0.0000
135 L L 0.0000
136 L L 0.0000
137 N L 0.0000
138 N L -1.3969
139 F L 0.0000
140 Y L 0.0000
141 P L -1.3044
142 R L -1.7354
143 E L -2.4651
144 A L -1.7255
145 K L -1.8289
146 V L -0.7033
147 Q L -0.2829
148 W L 0.0000
149 K L -0.4105
150 V L 0.0000
151 D L -1.7640
152 N L -1.4623
153 A L -0.2109
154 L L 0.8277
155 Q L -0.1991
156 S L -0.6272
157 G L -1.2545
158 N L -1.5707
159 S L -1.3234
160 Q L -1.1818
161 E L -1.1093
162 S L -0.5279
163 V L -0.3381
164 T L -0.9232
165 E L -2.0572
166 Q L -1.9419
167 D L -2.3940
168 S L -2.0594
169 K L -2.8633
170 D L -3.0199
171 S L 0.0000
172 T L 0.0000
173 Y L 0.0000
174 S L 0.0000
175 L L 0.0000
176 S L 0.0000
177 S L 0.0000
178 T L -0.5898
179 L L 0.0000
180 T L -0.7178
181 L L -0.8333
182 S L -1.2118
183 K L -2.2005
184 A L -1.9182
185 D L -2.3957
186 Y L 0.0000
187 E L -3.7177
188 K L -3.6147
189 H L -2.8936
190 K L -3.1515
191 V L -1.4821
192 Y L 0.0000
193 A L 0.0000
194 C L 0.0000
195 E L -0.7692
196 V L 0.0000
197 T L -1.0367
198 H L 0.0000
199 Q L -1.5382
200 G L -0.4686
201 L L -0.3133
202 S L -0.4612
203 S L -0.4567
204 P L -0.5950
205 V L -0.0475
206 T L -0.4824
207 K L -0.7675
208 S L -0.7346
209 F L 0.0000
210 N L -2.0075
211 R L -2.8905
212 G L -1.9714
213 E L -1.8212
214 C L 0.0000
1 E H -1.9562
2 V H -0.6307
3 Q H -1.2102
4 L H 0.0000
5 V H 1.2444
6 E H 0.0000
7 S H -0.2156
8 G H -0.5477
9 G H -0.4062
10 G H -0.0532
11 L H 0.2285
12 V H -0.2124
13 Q H -1.0684
14 P H -1.4995
15 G H -1.3443
16 G H -1.1320
17 S H -1.4511
18 L H -1.2710
19 R H -2.1016
20 L H 0.0000
21 S H -0.3026
22 C H 0.0000
23 A H 0.0109
24 A H 0.0000
25 S H -0.3568
26 G H -0.7201
27 F H 0.0000
28 A H -0.1996
29 F H 0.0000
30 S H -0.8209
31 T H -0.3237
32 Y H 0.0158
33 D H -0.2797
34 M H 0.0000
35 S H 0.0000
36 W H 0.0000
37 V H 0.0000
38 R H -0.6919
39 Q H -0.7618
40 A H -1.0392
41 P H -0.8726
42 G H -1.4639
43 K H -2.3443
44 G H -1.5691
45 L H 0.0000
46 E H -0.8832
47 W H 0.0000
48 V H 0.0000
49 A H 0.0000
50 T H 0.0000
51 I H 0.0000
52 S H -0.0865
53 S H 0.0000
54 G H -0.6669
55 G H -0.3927
56 S H -0.0943
57 Y H 1.0159
58 T H 0.7125
59 Y H 0.4138
60 Y H -0.6952
61 L H -1.3435
62 D H -2.6513
63 S H -1.6454
64 V H 0.0000
65 K H -2.7617
66 G H -2.0559
67 R H -2.3985
68 F H 0.0000
69 T H -1.0549
70 I H 0.0000
71 S H -0.2477
72 R H -1.1233
73 D H -1.3753
74 S H -1.3306
75 S H -1.4015
76 K H -2.2322
77 N H -1.5807
78 T H -0.8879
79 L H 0.0000
80 Y H -0.4159
81 L H 0.0000
82 Q H -1.3797
83 M H 0.0000
84 N H -2.0746
85 S H -1.5588
86 L H 0.0000
87 R H -2.3762
88 A H -1.6592
89 E H -2.2209
90 D H 0.0000
91 T H -0.4666
92 A H 0.0000
93 V H 0.5461
94 Y H 0.0000
95 Y H 0.0000
96 C H 0.0000
97 A H 0.0000
98 P H 0.0000
99 T H 0.0000
100 T H 0.7004
101 V H 1.3012
102 V H 1.1914
103 P H 0.1036
104 F H 0.5368
105 A H 0.0150
106 Y H 0.0000
107 W H 0.0000
108 G H 0.0000
109 Q H -1.0364
110 G H -0.3854
111 T H 0.0000
112 L H 1.2049
113 V H 0.0000
114 T H -0.1661
115 V H 0.0000
116 S H -0.8484
117 S H -0.6869
118 A H -0.4542
119 S H -0.5758
120 T H -0.8427
121 K H -1.3662
122 G H -1.4267
123 P H 0.0000
124 S H -0.4857
125 V H 0.0000
126 F H 0.0000
127 P H -1.0842
128 L H 0.0000
129 A H -0.9485
130 P H 0.0000
131 S H -1.2782
132 S H -1.5989
133 K H -1.9826
134 S H -1.3722
135 T H -0.9395
136 S H -0.8006
137 G H -0.7733
138 G H -0.5903
139 T H -0.4440
140 A H -0.3588
141 A H 0.0000
142 L H 0.0000
143 G H 0.0000
144 C H 0.0000
145 L H 0.0000
146 V H 0.0000
147 K H -0.3970
148 D H -0.6759
149 Y H 0.0000
150 F H 0.0000
151 P H -1.0108
152 E H -1.2531
153 P H -1.3239
154 V H 0.0000
155 T H -0.9596
156 V H -0.4674
157 S H -0.4049
158 W H 0.0000
159 N H -0.7670
160 S H -0.6392
161 G H -0.6351
162 A H -0.3127
163 L H -0.1027
164 T H -0.2385
165 S H -0.2207
166 G H -0.3359
167 V H 0.0823
168 H H -0.2966
169 T H 0.0149
170 F H 0.0000
171 P H -0.3973
172 A H -0.0908
173 V H 0.2063
174 L H 0.7258
175 Q H 0.1177
176 S H -0.1109
177 S H -0.2389
178 P H -0.0377 mutated: GH178P
179 L H -0.2152
180 Y H 0.0000
181 S H 0.0000
182 L H 0.0000
183 S H 0.0000
184 S H 0.0000
185 V H 0.0000
186 V H 0.0000
187 T H -0.1080
188 V H 0.0000
189 P H -0.6268
190 S H 0.0000
191 S H -0.7806
192 S H -0.7750
193 L H 0.0000
194 G H -1.2419
195 T H -1.1087
196 Q H -1.5123
197 T H -1.2132
198 Y H 0.0000
199 I H -1.1635
200 C H 0.0000
201 N H -1.2853
202 V H 0.0000
203 N H -2.2736
204 H H 0.0000
205 K H -2.9654
206 P H -1.8080
207 S H -1.8799
208 N H -2.6231
209 T H -2.1637
210 K H -2.6518
211 V H -1.3936
212 D H -1.8890
213 K H -1.6422
214 K H -2.3522
215 V H 0.0000
216 E H -2.5716
217 P H -1.5474
218 K H -1.3844
219 S H -1.3162
220 C H -1.8849
221 D H -2.8924
222 K H -2.7991
223 T H -2.1472
224 H H -1.8362
225 T H -1.3599
226 S H -0.6577
227 A H -1.1415
228 A H -1.2273

 

Laboratory of Theory of Biopolymers 2015