Project name: 3mxc_A_Valen

Status: done

submitted: 2018-10-09 16:04:07, status changed: 2018-10-09 16:09:01
Settings
Chain sequence(s) A: MKPHPWFFGKIPRAKAEEMLSKQRHDGAFLIRESESAPGDFSLSVKFGNDVQHFKVLRDGAGKYFLWVVKFNSLNELVDYHRSTSVSRNQQIFLRDIE
Distance of aggregation 10 Å
Dynamic mode No
Show buried residues

Minimal score value
-3.3109
Maximal score value
2.059
Average score
-1.1874
Total score value
-116.3678

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
55 M A 0.1093
56 K A -1.4545
57 P A -0.8837
58 H A -0.6058
59 P A -0.4200
60 W A 0.0000
61 F A 1.7242
62 F A 1.0027
63 G A -0.1724
64 K A -2.1610
65 I A 0.0000
66 P A -2.4930
67 R A -3.0412
68 A A -2.0777
69 K A -2.8172
70 A A 0.0000
71 E A -2.8322
72 E A -3.3109
73 M A -1.9380
74 L A 0.0000
75 S A -2.9184
76 K A -3.0692
77 Q A -2.6832
78 R A -3.0555
79 H A -2.6921
80 D A -1.9167
81 G A 0.0000
82 A A 0.0000
83 F A 0.0000
84 L A 0.0000
85 I A 0.0000
86 R A 0.0000
87 E A -1.8291
88 S A -2.4914
89 E A -2.9151
90 S A -1.5558
91 A A -1.3538
92 P A -1.5001
93 G A -1.2684
94 D A -1.7314
95 F A -1.3643
96 S A -1.2111
97 L A 0.0000
98 S A 0.0000
99 V A 0.0000
100 K A -1.8847
101 F A -1.4137
102 G A -1.7602
103 N A -2.4897
104 D A -2.8365
105 V A 0.0000
106 Q A -1.0771
107 H A -1.3093
108 F A -0.6788
109 K A -1.6567
110 V A 0.0000
111 L A -0.9503
112 R A -2.5149
113 D A -1.7503
114 G A -1.1635
115 A A -1.1053
116 G A -1.4645
117 K A -1.9449
118 Y A -1.2887
119 F A -0.4435
120 L A 0.0000
121 W A 1.1878
122 V A 2.0590
123 V A 0.9662
124 K A -1.4101
125 F A 0.0000
126 N A -2.2977
127 S A -1.4802
128 L A -0.7326
129 N A -1.5685
130 E A -2.5491
131 L A 0.0000
132 V A 0.0000
133 D A -2.3414
134 Y A -0.8427
135 H A 0.0000
136 R A -1.3159
137 S A -0.6482
138 T A -0.3884
139 S A -0.8959
140 V A 0.0000
141 S A -1.6529
142 R A -2.7572
143 N A -2.6644
144 Q A -2.0787
145 Q A -1.8986
146 I A 0.0000
147 F A -0.5794
148 L A 0.0000
149 R A -2.7131
150 D A -2.2799
151 I A -2.0850
152 E A -2.7413

 

Laboratory of Theory of Biopolymers 2015