Project name: San3 [mutate: FB8D, LB5R, LB3P, LB40D, LB27D]

Status: running

submitted: 2018-04-16 06:03:40, status changed: 2018-04-18 12:35:29
Settings
Chain sequence(s) B: LDLKLIIFQQRQVNQESLKLLNKLQTLSIQQCLPHRKNFLLPQKSLSPQQYQKGHTLAILHEMLQQIFSLFRANISLDGWEENHTEKFLIQLHQQLEYLEALMGLEAEKLSGTLGSDNLRLQVKMYFRRIHDYLENQDYSTCAWAIVQVEISRCLFFVFSLTEKLSK
Distance of aggregation 10 Å
Dynamic mode Yes
Mutated residues FB8D, LB5R, LB3P, LB40D, LB27D
Energy difference between WT (input) and mutated protein (by FoldX) None kcal/mol

 

Laboratory of Theory of Biopolymers 2015