Project name: mSQT_nonflex

Status: done

submitted: 2018-06-10 15:18:26, status changed: 2018-06-10 15:27:04
Settings
Chain sequence(s) A: MIPRGLSEAKPATPEIQEIVDKVKPQLEEKTNETYGKLEAVQYKTQVLDTYRYILASTNYYIKVRAGDNKYMHLKVFNGPEQKLISEEDLADRVLTGYQVDKNKDDELTGFENLYFQSHHHHHH
Distance of aggregation 10 Å
Dynamic mode No
Show buried residues

Minimal score value
-4.552
Maximal score value
1.5553
Average score
-1.4311
Total score value
-177.456

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 M A 1.3229
2 I A 1.0877
3 P A -0.0935
4 R A -1.0707
5 G A -0.1545
6 L A -0.1267
7 S A -0.7644
8 E A -2.0265
9 A A -1.5646
10 K A -1.4052
11 P A -0.7984
12 A A -0.9114
13 T A -1.2926
14 P A -1.8600
15 E A -3.0105
16 I A 0.0000
17 Q A -3.0410
18 E A -3.8612
19 I A 0.0000
20 V A 0.0000
21 D A -3.9044
22 K A -3.1510
23 V A 0.0000
24 K A -2.2611
25 P A -1.8999
26 Q A -2.0406
27 L A 0.0000
28 E A -2.5523
29 E A -3.4746
30 K A -2.9082
31 T A -2.1207
32 N A -2.9207
33 E A -2.2138
34 T A -1.4960
35 Y A 0.0000
36 G A -1.5687
37 K A -2.9307
38 L A -2.2308
39 E A -2.4024
40 A A -1.8058
41 V A -0.7311
42 Q A -1.0673
43 Y A -0.4902
44 K A -0.5307
45 T A 0.2053
46 Q A 0.0000
47 V A 1.5553
48 L A 0.2982
49 D A -1.0566
50 T A -0.6435
51 Y A -0.2416
52 R A -1.2428
53 Y A -0.2570
54 I A 0.3644
55 L A 0.4791
56 A A -0.3800
57 S A 0.0000
58 T A 0.6108
59 N A 0.0000
60 Y A 0.3852
61 Y A 0.0000
62 I A 0.0000
63 K A 0.0000
64 V A 0.0000
65 R A -3.1620
66 A A 0.0000
67 G A -2.8649
68 D A -3.3703
69 N A -3.6326
70 K A -3.2971
71 Y A 0.0000
72 M A 0.0000
73 H A 0.0000
74 L A 0.0000
75 K A 0.0000
76 V A 0.0000
77 F A 0.2411
78 N A -0.6654
79 G A -1.9925
80 P A -2.4501
81 E A -3.4758
82 Q A -3.7017
83 K A -3.7485
84 L A -3.3051
85 I A -3.5157
86 S A -3.7782
87 E A -3.8749
88 E A -4.2328
89 D A -4.1144
90 L A -3.1524
91 A A -2.9062
92 D A -2.6407
93 R A -1.4692
94 V A -0.4133
95 L A -0.2040
96 T A 0.1760
97 G A -0.0540
98 Y A -0.1127
99 Q A -1.1411
100 V A -1.1214
101 D A -2.7947
102 K A -3.3797
103 N A -4.1196
104 K A -4.5520
105 D A -3.7427
106 D A -3.1232
107 E A -3.0002
108 L A 0.0000
109 T A -0.9265
110 G A -1.0665
111 F A -0.9377
112 E A -2.0039
113 N A -1.5832
114 L A 0.0000
115 Y A -0.8422
116 F A -0.7360
117 Q A -1.6246
118 S A -1.5580
119 H A -1.5871
120 H A -1.6362
121 H A -1.4399
122 H A -1.5056
123 H A -1.6096
124 H A -1.5122

 

Laboratory of Theory of Biopolymers 2015