Project name: test5

Chain sequence(s)	A: GGSVQIVYKPVDLSKVTSKCGSLGNIHHKPGGGQVEVKSEKLDFKDRVQSKIGSLDNITHVPGGGNKKIETHKLTFREN
Distance of aggregation	10 Å
Dynamic mode	No

• Minimal score value: -3.009
• Maximal score value: 2.9291
• Average score: -0.8231
• Total score value: -65.0239

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
1	G	A	-0.7451
2	G	A	-0.4235
3	S	A	0.0404
4	V	A	1.2476
5	Q	A	1.0027
6	I	A	2.9291
7	V	A	2.6106
8	Y	A	1.8938
9	K	A	-0.2549
10	P	A	-0.2265
11	V	A	0.7661
12	D	A	-0.6383
13	L	A	0.5301
14	S	A	-0.4997
15	K	A	-1.2128
16	V	A	-0.3782
17	T	A	-0.5925
18	S	A	-1.0453
19	K	A	-1.7135
20	C	A	-0.3465
21	G	A	-0.3792
22	S	A	-0.0401
23	L	A	1.0623
24	G	A	-0.2999
25	N	A	-0.9766
26	I	A	-0.2341
27	H	A	-1.7951
28	H	A	-2.1025
29	K	A	-2.7378
30	P	A	-2.0661
31	G	A	-1.4008
32	G	A	-1.4278
33	G	A	-0.9162
34	Q	A	-1.2175
35	V	A	-0.0153
36	E	A	-1.4797
37	V	A	-0.4386
38	K	A	-2.2322
39	S	A	-1.9205
40	E	A	-2.7976
41	K	A	-2.2916
42	L	A	-0.2871
43	D	A	-0.9081
44	F	A	-0.2358
45	K	A	-2.2696
46	D	A	-3.0090
47	R	A	-2.7290
48	V	A	-1.1363
49	Q	A	-1.7722
50	S	A	-0.9792
51	K	A	-1.5079
52	I	A	0.2315
53	G	A	-0.3663
54	S	A	-0.3367
55	L	A	0.1838
56	D	A	-1.3445
57	N	A	-1.3920
58	I	A	0.5925
59	T	A	0.1177
60	H	A	-0.3710
61	V	A	0.4294
62	P	A	-0.5099
63	G	A	-0.7660
64	G	A	-1.1134
65	G	A	-1.5587
66	N	A	-2.1734
67	K	A	-2.5140
68	K	A	-2.1929
69	I	A	-0.1536
70	E	A	-1.6985
71	T	A	-1.4230
72	H	A	-1.9496
73	K	A	-1.7219
74	L	A	0.2272
75	T	A	0.0589
76	F	A	0.2181
77	R	A	-2.4344
78	E	A	-2.8404
79	N	A	-2.6253