Project name: fr-GFP [mutate: LA221D]

Status: done

submitted: 2018-06-15 16:02:02, status changed: 2018-06-15 16:13:15
Settings
Chain sequence(s) A: KGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLVQCFSRYPDHMKRHDFFKSAMPEGYVQERTISFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYITADKQKNGIKANFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITH
Distance of aggregation 10 Å
Dynamic mode No
Mutated residues LA221D
Energy difference between WT (input) and mutated protein (by FoldX) 1.46839 kcal/mol

CAUTION: Your mutation/s can destabilize the protein structure

Changes in protein stability upon mutation are calculated using the FoldX forcefield. Computational prediction of protein stability is used with the intention of preventing the experimental characterization of proteins bearing mutations that significantly destabilize their structure. Mutations resulting in a predicted reduction in protein stability ≥ 1 kcal/mol are considered disruptive.

Show buried residues

Minimal score value
-4.2779
Maximal score value
1.3523
Average score
-1.0488
Total score value
-237.0244

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
3 K A -2.4362
4 G A 0.0000
5 E A -2.4084
6 E A -2.4828
7 L A -0.8760
8 F A 0.0000
9 T A -0.2441
10 G A 0.5238
11 V A 1.3523
12 V A 0.0000
13 P A -0.9326
14 I A 0.0000
15 L A -1.3462
16 V A 0.0000
17 E A -2.6162
18 L A 0.0000
19 D A -3.6081
20 G A 0.0000
21 D A -2.8114
22 V A 0.0000
23 N A -2.1016
24 G A -1.7080
25 H A -2.2368
26 K A -3.0008
27 F A 0.0000
28 S A -1.8934
29 V A 0.0000
30 S A -1.2801
31 G A 0.0000
32 E A -2.2839
33 G A -1.6807
34 E A -1.4547
35 G A 0.0000
36 D A 0.0816
37 A A 0.0000
38 T A 0.1611
39 Y A 0.9685
40 G A 0.0000
41 K A -0.5773
42 L A 0.0000
43 T A -1.2574
44 L A 0.0000
45 K A -1.3992
46 F A 0.0000
47 I A -0.9342
48 C A 0.0000
49 T A -1.0341
50 T A -1.3311
51 G A -1.6471
52 K A -2.2716
53 L A 0.0000
54 P A -1.2304
55 V A 0.0000
56 P A -0.7442
57 W A 0.0000
58 P A 0.0000
59 T A 0.0000
60 L A 0.0000
61 V A 0.0000
62 T A 0.0001
63 T A 0.0000
64 L A 0.0000
68 V A 0.0079
69 Q A -0.1839
70 C A 0.0000
71 F A 0.0000
72 S A 0.0000
73 R A -1.2927
74 Y A 0.0000
75 P A -1.9175
76 D A -2.8574
77 H A -2.1422
78 M A 0.0000
79 K A -2.8504
80 R A -2.8547
81 H A -1.7277
82 D A 0.0000
83 F A 0.0000
84 F A 0.0000
85 K A 0.0000
86 S A -1.1996
87 A A 0.0000
88 M A 0.0000
89 P A -1.6187
90 E A -2.2005
91 G A 0.0000
92 Y A 0.0000
93 V A -0.8636
94 Q A 0.0000
95 E A -2.3532
96 R A 0.0000
97 T A -1.0670
98 I A 0.0000
99 S A -1.2960
100 F A 0.0000
101 K A -2.5427
102 D A -2.9337
103 D A -2.8715
104 G A 0.0000
105 N A -1.5683
106 Y A 0.0000
107 K A -2.5624
108 T A 0.0000
109 R A -3.4388
110 A A 0.0000
111 E A -2.3191
112 V A 0.0000
113 K A -1.6669
114 F A -1.8725
115 E A -2.6836
116 G A -2.2574
117 D A -2.3913
118 T A -1.5519
119 L A 0.0000
120 V A 0.0000
121 N A 0.0000
122 R A -3.4267
123 I A 0.0000
124 E A -4.2779
125 L A 0.0000
126 K A -3.1114
127 G A 0.0000
128 I A -1.2424
129 D A -2.2779
130 F A 0.0000
131 K A -3.9548
132 E A -3.9994
133 D A -3.6519
134 G A -2.8614
135 N A -2.3203
136 I A 0.0000
137 L A -2.0536
138 G A -2.3825
139 H A -2.2777
140 K A -2.6099
141 L A -1.9361
142 E A -2.3872
143 Y A -1.0035
144 N A -0.7001
145 Y A -0.8012
146 N A -1.0136
147 S A -1.0073
148 H A 0.0000
149 N A -1.4592
150 V A 0.0000
151 Y A -0.0400
152 I A 0.0000
153 T A -1.1445
154 A A -1.7207
155 D A -2.2292
156 K A -3.2073
157 Q A -3.1666
158 K A -3.2467
159 N A -2.8730
160 G A 0.0000
161 I A 0.0000
162 K A -1.0801
163 A A 0.0000
164 N A -1.2651
165 F A 0.0000
166 K A -1.8271
167 I A 0.0000
168 R A -1.1564
169 H A 0.0000
170 N A -1.4604
171 I A 0.0000
172 E A -3.4499
173 D A -3.0634
174 G A -1.8715
175 S A -0.8002
176 V A 0.1146
177 Q A 0.0000
178 L A -0.9215
179 A A 0.0000
180 D A -1.4493
181 H A 0.0000
182 Y A -0.3596
183 Q A 0.0000
184 Q A -1.1024
185 N A 0.0000
186 T A -0.7876
187 P A -0.9128
188 I A -0.3961
189 G A -1.3276
190 D A -2.1315
191 G A -1.4910
192 P A -0.7957
193 V A -0.1069
194 L A -0.2333
195 L A -0.6429
196 P A 0.0000
197 D A -2.4703
198 N A -1.8734
199 H A 0.0000
200 Y A -0.3017
201 L A 0.0000
202 S A -0.6326
203 T A -0.7990
204 Q A -1.3630
205 S A -0.8337
206 A A -0.4232
207 L A -0.4064
208 S A -0.8960
209 K A -1.9202
210 D A -2.1102
211 P A -1.8037
212 N A -2.4720
213 E A -2.7011
214 K A -3.3336
215 R A -3.3663
216 D A -2.2661
217 H A 0.0000
218 M A 0.0000
219 V A -0.7443
220 L A 0.0000
221 D A -1.0267 mutated: LA221D
222 E A -0.6828
223 F A 0.2332
224 V A 0.0000
225 T A -0.4136
226 A A 0.0000
227 A A -0.4267
228 G A -0.6622
229 I A -0.7212
230 T A -0.5728
231 H A -1.3146

 

Laboratory of Theory of Biopolymers 2015