Project name: 8f047139587eaf1 [mutate: FB19D, WB23D]

Status: done

submitted: 2018-04-17 07:14:35, status changed: 2018-04-17 17:23:13
Settings
Chain sequence(s) B: LSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIEQWFTEDPGP
Distance of aggregation 10 Å
Dynamic mode No
Mutated residues FB19D, WB23D
Energy difference between WT (input) and mutated protein (by FoldX) 0.654785 kcal/mol
Show buried residues

Minimal score value
-3.3639
Maximal score value
1.8919
Average score
-0.9431
Total score value
-44.3263

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
14 L B 0.8202
15 S B -0.6768
16 Q B -2.2372
17 E B -2.8039
18 T B -2.5808
19 D B -3.3450 mutated: FB19D
20 S B -2.6825
21 D B -3.0214
22 L B -1.1147
23 D B -1.8825 mutated: WB23D
24 K B -1.9755
25 L B 0.5867
26 L B 0.5367
27 P B -0.5542
28 E B -1.9145
29 N B -1.7346
30 N B -1.3614
31 V B 0.8476
32 L B 1.5765
33 S B 0.7897
34 P B 1.0768
35 L B 1.8919
36 P B 0.3060
37 S B -0.2263
38 Q B -1.1445
39 A B -0.5694
40 M B 0.3266
41 D B -1.2005
42 D B -0.5692
43 L B 0.9048
44 M B 1.4231
45 L B 0.3833
46 S B -0.9099
47 P B -2.1586
48 D B -3.3639
49 D B -3.0110
50 I B 0.0000
51 E B -2.8148
52 Q B -2.2713
53 W B 0.0556
54 F B 0.7776
55 T B -0.9023
56 E B -2.6758
57 D B -2.9949
58 P B -1.7268
59 G B -1.3968
60 P B -0.8084

 

Laboratory of Theory of Biopolymers 2015