Project name: ZEDIII AA [mutate: KE394A, EE393A]

Chain sequence(s)	E: MRLKGVSYSLCTAAFTFTKIPAETLHGTVTVEVQYAGTDGPCKVPAQMAVDMQTLTPVGRLITANPVITESTENSKMMLELDPPFGDSYIVIGVGEKKITHHWHRSGS
Distance of aggregation	10 Å
Dynamic mode	No
Mutated residues	KE394A, EE393A
Energy difference between WT (input) and mutated protein (by FoldX)	0.711841 kcal/mol Changes in protein stability upon mutation are calculated using the FoldX forcefield. Computational prediction of protein stability is used with the intention of preventing the experimental characterization of proteins bearing mutations that significantly destabilize their structure. Mutations resulting in a predicted reduction in protein stability ≥ 1 kcal/mol are considered disruptive.

• Minimal score value: -3.1517
• Maximal score value: 1.7172
• Average score: -0.3885
• Total score value: -41.9541

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
298	M	E	0.8394
299	R	E	-0.4913
300	L	E	1.0701
301	K	E	-0.2593
302	G	E	0.0000
303	V	E	1.7172
304	S	E	0.6322
305	Y	E	0.4989
306	S	E	0.3197
307	L	E	0.6338
308	C	E	0.0000
309	T	E	-0.1347
310	A	E	-0.1302
311	A	E	-0.1532
312	F	E	0.0000
313	T	E	-0.5151
314	F	E	0.0374
315	T	E	-0.5627
316	K	E	-0.6531
317	I	E	1.0062
318	P	E	0.0000
319	A	E	-0.4973
320	E	E	-1.5447
321	T	E	-0.5952
322	L	E	0.6094
323	H	E	-0.6391
324	G	E	-0.6601
325	T	E	-0.9103
326	V	E	0.0000
327	T	E	-0.3211
328	V	E	0.0000
329	E	E	-0.4694
330	V	E	0.0000
331	Q	E	-1.5048
332	Y	E	0.0000
333	A	E	-1.4618
334	G	E	-1.4677
335	T	E	-1.7128
336	D	E	-1.5655
337	G	E	0.0000
338	P	E	-0.9790
339	C	E	0.0000
340	K	E	-0.0140
341	V	E	0.0000
342	P	E	0.0000
343	A	E	-0.2035
344	Q	E	-0.4485
345	M	E	0.0000
346	A	E	0.0000
347	V	E	0.9070
348	D	E	-0.3303
349	M	E	-0.0077
350	Q	E	-1.0430
351	T	E	-0.5243
352	L	E	0.0684
353	T	E	-0.0287
354	P	E	-0.3898
355	V	E	-0.0497
356	G	E	-0.7735
357	R	E	-1.7600
358	L	E	-0.2087
359	I	E	0.5857
360	T	E	0.3228
361	A	E	-0.0134
362	N	E	-0.2579
363	P	E	0.0000
364	V	E	0.0000
365	I	E	0.0000
366	T	E	-1.1380
367	E	E	-2.3451
368	S	E	-1.8463
369	T	E	-1.9652
370	E	E	-3.1517
371	N	E	-2.8514
372	S	E	-2.4180
373	K	E	-2.3309
374	M	E	-0.6938
375	M	E	-0.1054
376	L	E	0.0000
377	E	E	-0.5183
378	L	E	0.0000
379	D	E	-0.9231
380	P	E	0.0000
381	P	E	-0.1000
382	F	E	0.4089
383	G	E	-0.6354
384	D	E	-1.6240
385	S	E	0.0000
386	Y	E	0.1739
387	I	E	0.0000
388	V	E	0.0000
389	I	E	0.0000
390	G	E	0.0000
391	V	E	0.6492
392	G	E	-0.1121
393	A	E	-0.0879	mutated: EE393A
394	A	E	-0.1038	mutated: KE394A
395	K	E	-0.2726
396	I	E	0.1852
397	T	E	-0.0326
398	H	E	-0.0045
399	H	E	-0.8225
400	W	E	-1.0051
401	H	E	-1.6658
402	R	E	-1.1577
403	S	E	-0.7380
404	G	E	-0.4890
405	S	E	-0.1999