Project name: a3e2b2b32fb2117

Status: done

submitted: 2018-03-09 12:46:13, status changed: 2018-03-09 13:30:06
Settings
Chain sequence(s) A: GDVEKGKKIFIMKCSQCHTVEKGGKHKTGPNLHGLFGRKTSQAPGYSYTAANKNKGIIWGEDTLMEYLENPKKYIPGTKMIFVGIKKKEERADLIAYLKKATNE
Distance of aggregation 10 Å
Dynamic mode No
Show buried residues

Minimal score value
-4.037
Maximal score value
2.0781
Average score
-1.3636
Total score value
-141.8139

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 G A -2.3070
2 D A -3.2002
3 V A -2.7911
4 E A -3.5544
5 K A -3.6624
6 G A 0.0000
7 K A -2.6927
8 K A -2.2073
9 I A 0.0000
10 F A 0.0000
11 I A 1.0464
12 M A 0.5867
13 K A -0.6557
14 C A -0.3026
15 S A -0.1600
16 Q A -1.0347
17 C A -0.7920
18 H A -1.1035
19 T A -1.5215
20 V A 0.0000
21 E A -3.7356
22 K A -3.6976
23 G A -2.3364
24 G A -2.5665
25 K A -2.8024
26 H A -1.8132
27 K A -1.7112
28 T A -0.8376
29 G A 0.0000
30 P A -0.9243
31 N A -1.6833
32 L A -1.1064
33 H A -2.1963
34 G A -1.6038
35 L A 0.0000
36 F A -0.8322
37 G A -0.4836
38 R A -0.8713
39 K A -1.5186
40 T A 0.0000
41 S A -1.7806
42 Q A -1.9171
43 A A 0.0000
44 P A -0.7847
45 G A -0.9129
46 Y A -0.7147
47 S A -0.4881
48 Y A -0.8192
49 T A -0.9061
50 A A -1.2319
51 A A -1.5035
52 N A -2.0267
53 K A -2.9181
54 N A -2.5573
55 K A -1.7496
56 G A -1.2169
57 I A -0.0925
58 I A 0.4340
59 W A 0.0000
60 G A -1.0690
61 E A -2.1365
62 D A -2.4932
63 T A -1.3223
64 L A 0.0000
65 M A -2.2874
66 E A -3.1224
67 Y A 0.0000
68 L A 0.0000
69 E A -3.0792
70 N A -2.1632
71 P A 0.0000
72 K A -2.4392
73 K A -3.1223
74 Y A -2.0804
75 I A 0.0000
76 P A -1.8425
77 G A -1.5207
78 T A 0.0000
79 K A -1.0058
80 M A 0.5499
81 I A 2.0781
82 F A 1.4590
83 V A 1.5857
84 G A -0.7678
85 I A 0.0000
86 K A -3.1865
87 K A -3.6460
88 K A -4.0370
89 E A -3.7447
90 E A -3.4037
91 R A 0.0000
92 A A -2.3661
93 D A -3.0112
94 L A 0.0000
95 I A 0.0000
96 A A -2.0407
97 Y A 0.0000
98 L A 0.0000
99 K A -2.4577
100 K A -2.9157
101 A A -2.7456
102 T A 0.0000
103 N A -3.5205
104 E A -3.7011

 

Laboratory of Theory of Biopolymers 2015