Project name: 2a3076f97752840 [mutate: VA3E]

Status: done

submitted: 2018-01-12 15:47:43, status changed: 2018-01-12 15:53:25
Settings
Chain sequence(s) A: IDVLLGADDGSLAFVPSEFSISPGEKIVFKNNAGFPHNIVFDEDSIPSGVDASKISMSEEDLLNAKGETFEVALSNKGEYSFYCSPHQGAGMVGKVTVN
Distance of aggregation 10 Å
Dynamic mode No
Mutated residues VA3E
Energy difference between WT (input) and mutated protein (by FoldX) 6.27561 kcal/mol
Show buried residues

Minimal score value
-3.2265
Maximal score value
0.1577
Average score
-1.1513
Total score value
-113.9779

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 I A -0.4449
2 D A -1.5668
3 E A 0.0000 mutated: VA3E
4 L A -0.3535
5 L A 0.0000
6 G A 0.0000
7 A A -1.3237
8 D A -2.6778
9 D A -2.8699
10 G A -1.8111
11 S A -0.9372
12 L A -0.0958
13 A A 0.1577
14 F A 0.0000
15 V A -0.0084
16 P A -0.3865
17 S A -0.6874
18 E A -1.9268
19 F A -0.7980
20 S A -1.0935
21 I A 0.0000
22 S A -1.6444
23 P A -1.8218
24 G A -1.3776
25 E A -1.5688
26 K A -2.2419
27 I A 0.0000
28 V A -1.4175
29 F A 0.0000
30 K A -1.7094
31 N A 0.0000
32 N A -1.3981
33 A A -1.2290
34 G A -0.8382
35 F A -0.2510
36 P A -0.5504
37 H A 0.0000
38 N A 0.0000
39 I A 0.0000
40 V A 0.0000
41 F A 0.0000
42 D A -2.1228
43 E A -3.2265
44 D A -2.9227
45 S A -2.1443
46 I A -2.1184
47 P A -1.7659
48 S A -1.2838
49 G A -0.8529
50 V A -1.3557
51 D A -2.0943
52 A A -2.0917
53 S A -1.6496
54 K A -2.1169
55 I A 0.0000
56 S A -1.4924
57 M A -1.1246
58 S A -1.8621
59 E A -2.9589
60 E A -3.1081
61 D A -2.3430
62 L A -0.8149
63 L A 0.0000
64 N A -1.5801
65 A A -1.6611
66 K A -2.5001
67 G A -1.9510
68 E A -1.7470
69 T A -1.4729
70 F A -0.8789
71 E A -2.0834
72 V A 0.0000
73 A A -1.6446
74 L A 0.0000
75 S A -1.8214
76 N A -2.6966
77 K A -3.2208
78 G A -2.3743
79 E A -2.5246
80 Y A 0.0000
81 S A -1.4981
82 F A 0.0000
83 Y A -0.3335
84 C A 0.0000
85 S A -1.1686
86 P A -0.8934
87 H A -0.5980
88 Q A -0.9724
89 G A -0.9386
90 A A -0.5229
91 G A -0.5170
92 M A 0.0000
93 V A 0.0773
94 G A 0.0000
95 K A -1.7000
96 V A 0.0000
97 T A -2.0549
98 V A 0.0000
99 N A -2.3798

 

Laboratory of Theory of Biopolymers 2015