Aggrescan3D: 2a3076f97752840 [mutate: VA3E]

Settings

Chain sequence(s)	A: IDVLLGADDGSLAFVPSEFSISPGEKIVFKNNAGFPHNIVFDEDSIPSGVDASKISMSEEDLLNAKGETFEVALSNKGEYSFYCSPHQGAGMVGKVTVN
Distance of aggregation	10 Å
Dynamic mode	No
Mutated residues	VA3E
Energy difference between WT (input) and mutated protein (by FoldX)	6.27561 kcal/mol CAUTION: Your mutation/s can destabilize the protein structure Changes in protein stability upon mutation are calculated using the FoldX forcefield. Computational prediction of protein stability is used with the intention of preventing the experimental characterization of proteins bearing mutations that significantly destabilize their structure. Mutations resulting in a predicted reduction in protein stability ≥ 1 kcal/mol are considered disruptive.

Drag cursor over the plot to display residue labels.

Show buried residues

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
residue index	residue name	chain	Aggrescan3D score	mutation
1	I	A	-0.4449
2	D	A	-1.5668
3	E	A	0.0000	mutated: VA3E
4	L	A	-0.3535
5	L	A	0.0000
6	G	A	0.0000
7	A	A	-1.3237
8	D	A	-2.6778
9	D	A	-2.8699
10	G	A	-1.8111
11	S	A	-0.9372
12	L	A	-0.0958
13	A	A	0.1577
14	F	A	0.0000
15	V	A	-0.0084
16	P	A	-0.3865
17	S	A	-0.6874
18	E	A	-1.9268
19	F	A	-0.7980
20	S	A	-1.0935
21	I	A	0.0000
22	S	A	-1.6444
23	P	A	-1.8218
24	G	A	-1.3776
25	E	A	-1.5688
26	K	A	-2.2419
27	I	A	0.0000
28	V	A	-1.4175
29	F	A	0.0000
30	K	A	-1.7094
31	N	A	0.0000
32	N	A	-1.3981
33	A	A	-1.2290
34	G	A	-0.8382
35	F	A	-0.2510
36	P	A	-0.5504
37	H	A	0.0000
38	N	A	0.0000
39	I	A	0.0000
40	V	A	0.0000
41	F	A	0.0000
42	D	A	-2.1228
43	E	A	-3.2265
44	D	A	-2.9227
45	S	A	-2.1443
46	I	A	-2.1184
47	P	A	-1.7659
48	S	A	-1.2838
49	G	A	-0.8529
50	V	A	-1.3557
51	D	A	-2.0943
52	A	A	-2.0917
53	S	A	-1.6496
54	K	A	-2.1169
55	I	A	0.0000
56	S	A	-1.4924
57	M	A	-1.1246
58	S	A	-1.8621
59	E	A	-2.9589
60	E	A	-3.1081
61	D	A	-2.3430
62	L	A	-0.8149
63	L	A	0.0000
64	N	A	-1.5801
65	A	A	-1.6611
66	K	A	-2.5001
67	G	A	-1.9510
68	E	A	-1.7470
69	T	A	-1.4729
70	F	A	-0.8789
71	E	A	-2.0834
72	V	A	0.0000
73	A	A	-1.6446
74	L	A	0.0000
75	S	A	-1.8214
76	N	A	-2.6966
77	K	A	-3.2208
78	G	A	-2.3743
79	E	A	-2.5246
80	Y	A	0.0000
81	S	A	-1.4981
82	F	A	0.0000
83	Y	A	-0.3335
84	C	A	0.0000
85	S	A	-1.1686
86	P	A	-0.8934
87	H	A	-0.5980
88	Q	A	-0.9724
89	G	A	-0.9386
90	A	A	-0.5229
91	G	A	-0.5170
92	M	A	0.0000
93	V	A	0.0773
94	G	A	0.0000
95	K	A	-1.7000
96	V	A	0.0000
97	T	A	-2.0549
98	V	A	0.0000
99	N	A	-2.3798