Project name: ae85cde86184e9a

Chain sequence(s)	A: HAEGTFTSDVSSYLEGQAAKEFIAWLVRGRG
Distance of aggregation	10 Å
Dynamic mode	No

• Minimal score value: -2.0558
• Maximal score value: 2.132
• Average score: -0.1488
• Total score value: -4.6143

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
7	H	A	-1.3887
8	A	A	-1.4179
9	E	A	-1.9755
10	G	A	-0.9809
11	T	A	0.0352
12	F	A	1.3450
13	T	A	0.3604
14	S	A	0.1769
15	D	A	0.1321
16	V	A	1.2144
17	S	A	0.4938
18	S	A	0.1926
19	Y	A	1.0056
20	L	A	1.0412
21	E	A	-1.2328
22	G	A	-1.5207
23	Q	A	-2.0558
24	A	A	-1.1879
25	A	A	-1.0822
26	K	A	-1.8177
27	E	A	-1.3511
28	F	A	1.7026
29	I	A	2.1320
30	A	A	1.2413
31	W	A	1.7352
32	L	A	1.7447
33	V	A	1.6075
34	R	A	-0.5687
35	G	A	-1.2247
36	R	A	-1.6832
37	G	A	-1.2870