Project name: 2JV1

Status: done

submitted: 2018-08-05 10:56:09, status changed: 2018-08-05 11:01:46
Settings
Chain sequence(s) A: GIVEQCCTSICSLYQLENYCN
B: FVNQHLCGSHLVEALYLVCGERGFFYTPKT
Distance of aggregation 5 Å
Dynamic mode No
Show buried residues

Minimal score value
-2.1859
Maximal score value
2.2529
Average score
-0.1441
Total score value
-7.3475

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 G A -0.1886
2 I A 0.0000
3 V A -0.0428
4 E A -1.7078
5 Q A -1.1550
6 C A 0.0000
7 C A 0.1807
8 T A -0.0613
9 S A 0.0328
10 I A 1.1814
11 C A 0.0000
12 S A -0.1388
13 L A 0.8218
14 Y A 1.3375
15 Q A -0.2307
16 L A 0.0000
17 E A -2.0458
18 N A -1.5535
19 Y A 0.0388
20 C A 0.0716
21 N A -1.1678
1 F B 2.2529
2 V B 1.8863
3 N B -1.1742
4 Q B -1.6078
5 H B -1.0768
6 L B 0.0000
7 C B 0.3370
8 G B -0.4321
9 S B -0.4752
10 H B -1.2110
11 L B 0.0000
12 V B 0.3336
13 E B -1.8016
14 A B 0.0000
15 L B 0.0000
16 Y B 0.9789
17 L B 1.7197
18 V B 0.5394
19 C B 0.0000
20 G B -0.4931
21 E B -2.1755
22 R B -2.1859
23 G B -0.3118
24 F B 0.9181
25 F B 2.1881
26 Y B 1.0070
27 T B 0.0367
28 P B -0.3940
29 K B -1.3111
30 T B -0.2676

 

Laboratory of Theory of Biopolymers 2015