Project name: Valen_Spliceo_A_Stat

Chain sequence(s)	A: GTPEQLQAWRWEREIDERNRPLSDEELDAMFPEGYKVLPPPAGYVPI
Distance of aggregation	10 Å
Dynamic mode	No

• Minimal score value: -4.2001
• Maximal score value: 2.5861
• Average score: -0.7917
• Total score value: -37.2084

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
378	G	A	-0.8009
379	T	A	-1.1345
380	P	A	-1.5818
381	E	A	-2.2995
382	Q	A	-1.6476
383	L	A	0.0402
384	Q	A	-0.4126
385	A	A	-0.0036
386	W	A	0.3191
387	R	A	-1.0762
388	W	A	-1.0077
389	E	A	-2.7035
390	R	A	-3.0927
391	E	A	-2.6427
392	I	A	-0.8085
393	D	A	-2.8564
394	E	A	-3.8836
395	R	A	-4.2001
396	N	A	-3.6130
397	R	A	-3.2525
398	P	A	-1.5256
399	L	A	-0.0657
400	S	A	-1.4099
401	D	A	-2.8298
402	E	A	-3.4090
403	E	A	-2.1465
404	L	A	-0.7770
405	D	A	-1.6557
406	A	A	-0.7777
407	M	A	0.7916
408	F	A	1.3331
409	P	A	-0.1326
410	E	A	-1.6529
411	G	A	-0.7660
412	Y	A	0.4576
413	K	A	-0.0441
414	V	A	1.6627
415	L	A	1.9422
416	P	A	0.5967
417	P	A	0.2814
418	P	A	0.2770
419	A	A	0.2544
420	G	A	0.5424
421	Y	A	1.7770
422	V	A	2.5861
423	P	A	1.8617
424	I	A	2.2783