Project name: DI1000160 chain U

Status: done

submitted: 2018-05-31 10:13:58, status changed: 2018-05-31 10:18:28
Settings
Chain sequence(s) U: MAVTITLKTLQQQTFKIRMEPDETVKVLKEKIEAEKGRDAFPVAGQKLIYAGKILSDDVPIRDYRIDEKNFVVVMVTK
Distance of aggregation 10 Å
Dynamic mode No
Show buried residues

Minimal score value
-4.295
Maximal score value
0.9477
Average score
-1.2908
Total score value
-100.6803

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 M U 0.9477
2 A U 0.0147
3 V U 0.0093
4 T U -1.1623
5 I U 0.0000
6 T U 0.0000
7 L U 0.0000
8 K U -0.6829
9 T U 0.0000
10 L U 0.3514
11 Q U -1.5520
12 Q U -1.8595
13 Q U -1.9778
14 T U -1.0259
15 F U -0.9140
16 K U -2.2135
17 I U 0.0000
18 R U -1.9817
19 M U 0.0000
20 E U -1.8454
21 P U -2.8921
22 D U -3.2518
23 E U -2.8910
24 T U -2.3386
25 V U 0.0000
26 K U -1.9695
27 V U -1.5792
28 L U 0.0000
29 K U 0.0000
30 E U -2.6971
31 K U -2.6124
32 I U 0.0000
33 E U 0.0000
34 A U -2.5704
35 E U -3.0690
36 K U -2.8481
37 G U -2.8316
38 R U -3.5864
39 D U -3.2466
40 A U -1.9157
41 F U 0.0000
42 P U -1.9664
43 V U -1.4297
44 A U -1.0871
45 G U -0.8083
46 Q U 0.0000
47 K U -0.4034
48 L U 0.0000
49 I U 0.4006
50 Y U -0.5474
51 A U -0.5548
52 G U -0.7360
53 K U -1.1667
54 I U 0.2732
55 L U 0.0000
56 S U -0.8711
57 D U -1.6703
58 D U -2.1372
59 V U -1.6970
60 P U -2.8064
61 I U 0.0000
62 R U -4.2950
63 D U -3.4955
64 Y U -2.3852
65 R U -3.3811
66 I U 0.0000
67 D U -2.8300
68 E U -3.3208
69 K U -3.3102
70 N U -2.8679
71 F U -1.1276
72 V U 0.0000
73 V U 0.6162
74 V U 0.0000
75 M U 0.7887
76 V U -0.2859
77 T U -1.0322
78 K U -2.3544

 

Laboratory of Theory of Biopolymers 2015