Project name: cbb5f894b5b86ee

Chain sequence(s)	A: MDRLHPVHAGPIAPGQMREPRGSDIAGTTSTLQEQIGWMTHNPPIPVGEIYKRWIILGLNKIVRMYSPTSILDIRQGPKEPFRD
Distance of aggregation	10 Å
Dynamic mode	No

• Minimal score value: -2.4534
• Maximal score value: 2.4612
• Average score: -0.3057
• Total score value: -25.6786

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
1	M	A	-0.4727
2	D	A	-1.6286
3	R	A	-1.6761
4	L	A	0.2276
5	H	A	-0.5934
6	P	A	-0.3901
7	V	A	0.5223
8	H	A	-0.3316
9	A	A	-0.0482
10	G	A	-0.1417
11	P	A	0.1423
12	I	A	0.7703
13	A	A	0.0683
14	P	A	-0.4786
15	G	A	-0.9445
16	Q	A	-1.3335
17	M	A	-0.6145
18	R	A	-0.5891
19	E	A	-0.4836
20	P	A	0.0000
21	R	A	-0.8395
22	G	A	-0.6085
23	S	A	-0.3719
24	D	A	0.0000
25	I	A	0.0000
26	A	A	-0.0441
27	G	A	-0.0938
28	T	A	-0.2431
29	T	A	-0.2925
30	S	A	-0.1916
31	T	A	0.2093
32	L	A	0.9855
33	Q	A	-0.2909
34	E	A	-0.2508
35	Q	A	0.3452
36	I	A	0.9476
37	G	A	-0.1708
38	W	A	0.0000
39	M	A	0.0886
40	T	A	-0.0828
41	H	A	-1.0093
42	N	A	-1.6800
43	P	A	-1.0824
44	P	A	-0.4286
45	I	A	0.1313
46	P	A	-0.2720
47	V	A	0.0000
48	G	A	-1.2847
49	E	A	-2.3090
50	I	A	-0.9394
51	Y	A	-0.7347
52	K	A	-2.1036
53	R	A	-1.8007
54	W	A	0.0582
55	I	A	0.4109
56	I	A	0.5282
57	L	A	0.6559
58	G	A	0.4357
59	L	A	0.8561
60	N	A	-0.2956
61	K	A	-0.5274
62	I	A	0.9941
63	V	A	1.1775
64	R	A	-0.6125
65	M	A	1.0833
66	Y	A	1.5132
67	S	A	0.4691
68	P	A	0.2953
69	T	A	0.4543
70	S	A	1.0960
71	I	A	2.4612
72	L	A	1.9050
73	D	A	-0.0460
74	I	A	1.0229
75	R	A	-1.4453
76	Q	A	-2.4534
77	G	A	-1.7468
78	P	A	-1.6145
79	K	A	-2.0738
80	E	A	-2.0971
81	P	A	-1.0736
82	F	A	-0.2843
83	R	A	-2.0139
84	D	A	-2.3987