Project name: 3IWL

Chain sequence(s)	A: PKHEFSVDMTCGGCAEAVSRVLNKLGGVKYDIDLPNKKVCIESEHSMDTLLATLKKTGKTVSYLGL
Distance of aggregation	10 Å
Dynamic mode	No

• Minimal score value: -3.561
• Maximal score value: 1.1504
• Average score: -1.2475
• Total score value: -82.333

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
2	P	A	-1.7257
3	K	A	-2.6023
4	H	A	0.0000
5	E	A	-0.7526
6	F	A	0.0000
7	S	A	-1.2401
8	V	A	0.0000
9	D	A	-2.5317
10	M	A	0.0000
11	T	A	-0.5082
12	C	A	-0.1433
13	G	A	-0.6578
14	G	A	-1.0541
15	C	A	-1.2856
16	A	A	-1.7450
17	E	A	-2.4012
18	A	A	-2.1250
19	V	A	0.0000
20	S	A	-2.2715
21	R	A	-3.1508
22	V	A	0.0000
23	L	A	0.0000
24	N	A	-2.8893
25	K	A	-2.6963
26	L	A	-1.2614
27	G	A	-1.5979
28	G	A	-1.7937
29	V	A	0.0000
30	K	A	-2.9569
31	Y	A	-2.1860
32	D	A	-2.2320
33	I	A	-1.3528
34	D	A	-1.7745
35	L	A	-1.3465
36	P	A	-1.2528
37	N	A	-2.5054
38	K	A	-2.7509
39	K	A	-2.3475
40	V	A	0.0000
41	C	A	-1.5384
42	I	A	0.0000
43	E	A	-3.5610
44	S	A	0.0000
45	E	A	-2.6415
46	H	A	-1.7528
47	S	A	-1.1946
48	M	A	-0.9486
49	D	A	-1.6523
50	T	A	-0.9108
51	L	A	0.0000
52	L	A	-0.7590
53	A	A	-1.1480
54	T	A	-1.3081
55	L	A	0.0000
56	K	A	-2.3579
57	K	A	-2.5306
58	T	A	-2.2453
59	G	A	-1.8916
60	K	A	-1.9047
61	T	A	-1.4210
62	V	A	-1.0515
63	S	A	-0.2340
64	Y	A	0.9286
65	L	A	1.1504
66	G	A	0.8681
67	L	A	0.9104