Project name: To18

Status: done

submitted: 2018-07-03 06:20:59, status changed: 2018-07-03 06:27:17
Settings
Chain sequence(s) A: MMLLDAPTDLQVVTTNNVTDTSIITVVSSWTPPSSAATITGYRITYTPSNGPGEEPKELLTVPPSSTSVTITGLTPGVEYVVVSVYALKDNNQESPPLVGTQTTGGHHHHHH
Distance of aggregation 10 Å
Dynamic mode No
Show buried residues

Minimal score value
-2.8745
Maximal score value
1.5314
Average score
-0.739
Total score value
-72.423

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 M A 0.3841
2 L A 0.0000
3 D A -0.9438
4 A A -0.4109
5 P A 0.0000
6 T A -0.9243
7 D A -1.7072
8 L A -0.6909
9 Q A -1.2520
10 V A -0.3905
11 T A -0.5258
12 N A -0.9681
13 V A -0.1451
14 T A -0.4297
15 D A -1.0149
16 T A -0.4750
17 S A -0.4595
18 I A 0.0000
19 T A -0.3086
20 V A 0.0000
21 S A -0.6498
22 W A 0.0000
23 T A -0.7545
24 P A -0.6204
25 P A -0.4595
26 S A -0.4579
27 A A -0.2167
28 T A -0.1827
29 I A -0.6191
30 T A -0.9036
31 G A 0.0000
32 Y A 0.0000
33 R A -0.6615
34 I A 0.0000
35 T A 0.0000
36 Y A -0.8199
37 T A 0.0000
38 P A -1.3583
39 S A -1.4187
40 N A -1.6981
41 G A -1.5811
42 P A -1.4382
43 G A -1.9702
44 E A -2.7435
45 P A -2.3436
46 K A -2.7392
47 E A -2.6216
48 L A -0.8322
49 T A -0.2809
50 V A 0.0575
51 P A -0.2774
52 P A -0.3273
53 S A -0.3342
54 S A -0.2178
55 T A -0.1802
56 S A -0.1039
57 V A 0.1880
58 T A -0.0530
59 I A 0.0000
60 T A -0.3973
61 G A -0.6173
62 L A 0.0000
63 T A -0.5715
64 P A -1.2816
65 G A -1.2901
66 V A -0.9044
67 E A -1.3745
68 Y A 0.0000
69 V A 0.1052
70 V A 0.0000
71 S A 0.5261
72 V A 0.0000
73 Y A -0.2545
74 A A 0.0000
75 L A -1.3692
76 K A -1.7994
77 D A -2.8745
78 N A -2.7151
79 Q A -2.0348
80 E A -1.9588
81 S A 0.0000
82 P A -0.3386
83 P A 0.0469
84 L A 0.5162
85 V A 1.5314
86 G A 0.5309
87 T A -0.0334
88 Q A -0.4890
89 T A -0.7953
90 T A 0.0000
91 G A -1.0364
92 G A -1.7692
93 H A -2.1340
94 H A -2.2791
95 H A -2.5910
96 H A -2.3331
97 H A -1.9905
98 H A -1.5654

 

Laboratory of Theory of Biopolymers 2015