Project name: 2df6 modified

Status: done

submitted: 2018-12-11 11:43:37, status changed: 2018-12-11 11:47:12
Settings
Chain sequence(s) A: GPLGSVVRAKFNFQQTNEDELSFSKGDVIHVTRVEEGGWWEGTHNGRTGWFPSNYVREI
C: PPVIAPRPEHTKSIYTRS
Distance of aggregation 10 Å
Dynamic mode No
Show buried residues

Minimal score value
-2.8292
Maximal score value
2.0148
Average score
-0.7857
Total score value
-60.4962

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
5 G A -0.0557
6 P A -0.2809
7 L A 0.6393
8 G A -0.1355
9 S A -0.1017
10 V A 0.1937
11 V A 0.0000
12 R A -2.1524
13 A A 0.0000
14 K A -2.6984
15 F A -2.0651
16 N A -2.4227
17 F A 0.0000
18 Q A -1.7217
19 Q A -1.6856
20 T A -1.3136
21 N A -1.8420
22 E A -2.2313
23 D A -1.2495
24 E A 0.0000
25 L A 0.0000
26 S A -1.4319
27 F A 0.0000
28 S A -2.0718
29 K A -2.8292
30 G A -2.0503
31 D A -1.7308
32 V A -0.8935
33 I A 0.0000
34 H A -1.0627
35 V A 0.0000
36 T A -0.6823
37 R A -1.4282
38 V A -0.8692
39 E A -1.7428
40 E A -2.2536
41 G A -1.5823
42 G A -0.6037
43 W A 0.0000
44 W A -0.8673
45 E A -0.8503
46 G A 0.0000
47 T A -1.3151
48 H A -1.5254
49 N A -1.9952
50 G A -1.7060
51 R A -1.8739
52 T A -1.3923
53 G A 0.0000
54 W A 0.0000
55 F A 0.0000
56 P A 0.0000
57 S A -0.7019
58 N A -0.4747
59 Y A 0.0000
60 V A 0.0000
61 R A -2.1078
62 E A -1.6066
63 I A 0.7373
180 P C -0.0602
181 P C 0.7031
182 V C 1.8579
183 I C 1.2167
184 A C 0.4840
185 P C -0.1866
186 R C 0.0000
187 P C -1.8983
188 E C -2.6461
189 H C -2.2934
190 T C 0.0000
191 K C -1.6260
192 S C 0.0788
193 I C 2.0148
194 Y C 1.0575
195 T C -0.6205
196 R C -1.3064
197 S C -1.2369

 

Laboratory of Theory of Biopolymers 2015