Project name: 5urn_B

Chain sequence(s)	B: GSPGYPNGLLSGDEDFSSIADMDFSALLSQISS
Distance of aggregation	10 Å
Dynamic mode	No

• Minimal score value: -3.2837
• Maximal score value: 2.4089
• Average score: 0.0575
• Total score value: 1.8972

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
519	G	B	-0.6736
520	S	B	-0.6699
521	P	B	-0.4469
522	G	B	-0.2496
523	Y	B	0.6061
524	P	B	-0.2795
525	N	B	-0.6130
526	G	B	0.0648
527	L	B	1.2196
528	L	B	1.5095
529	S	B	-0.1154
530	G	B	-1.2065
531	D	B	-2.7337
532	E	B	-3.2837
533	D	B	-2.2344
534	F	B	-0.7455
535	S	B	-1.1083
536	S	B	-0.6135
537	I	B	1.0846
538	A	B	0.0524
539	D	B	-0.6402
540	M	B	0.6028
541	D	B	-0.0866
542	F	B	1.6201
543	S	B	0.8292
544	A	B	1.1490
545	L	B	2.4089
546	L	B	2.2675
547	S	B	1.1743
548	Q	B	0.8154
549	I	B	1.6414
550	S	B	0.4009
551	S	B	0.1510