Project name: 550_-11.499843_1

Status: done

submitted: 2019-10-02 09:02:49, status changed: 2019-10-02 09:09:59
Settings
Chain sequence(s) A: TTVARVLPAKPEDVGKGIVRMDKYERQNAGASVGEPVEVDGSKTTTVARVLPAKPEDVGKGIVRMDKYERQNAGASVGEPVEVDG
Distance of aggregation 10 Å
Dynamic mode No
Show buried residues

Minimal score value
-2.5315
Maximal score value
0.3597
Average score
-0.9492
Total score value
-80.6822

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 T A -0.8892
2 T A 0.0000
3 V A 0.3597
4 A A 0.0000
5 R A -2.1708
6 V A 0.0000
7 L A -0.3698
8 P A -0.3479
9 A A -1.1141
10 K A -1.6732
11 P A -1.2147
12 E A -2.0877
13 D A 0.0000
14 V A -0.1238
15 G A -0.8233
16 K A -1.7400
17 G A -0.9971
18 I A 0.0000
19 V A 0.0000
20 R A -0.8224
21 M A 0.0000
22 D A 0.0000
23 K A -1.4954
24 Y A -0.6955
25 E A 0.0000
26 R A -1.7348
27 Q A -2.2628
28 N A -2.0711
29 A A 0.0000
30 G A -1.8538
31 A A -1.8138
32 S A -1.0371
33 V A -0.1019
34 G A -0.8483
35 E A -1.7939
36 P A -1.6331
37 V A 0.0000
38 E A -1.6300
39 V A 0.0000
40 D A -1.7521
41 G A -2.1189
42 S A -1.8034
43 K A -2.5315
44 T A -1.3760
45 T A -0.8055
46 T A -0.4083
47 V A 0.2883
48 A A 0.0000
49 R A -2.2213
50 V A 0.0000
51 L A -0.4676
52 P A -0.4146
53 A A -1.3194
54 K A -1.8036
55 P A -1.3408
56 E A -2.1849
57 D A 0.0000
58 V A -0.3405
59 G A -0.8668
60 K A -1.6925
61 G A -0.9045
62 I A -1.0509
63 V A 0.0000
64 R A -0.7554
65 M A 0.0000
66 D A 0.0000
67 K A -1.5585
68 Y A -0.7906
69 E A 0.0000
70 R A -1.9132
71 Q A -2.4585
72 N A -2.3119
73 A A 0.0000
74 G A -1.9950
75 A A 0.0000
76 S A -0.9982
77 V A -0.0905
78 G A -0.8533
79 E A -1.7365
80 P A -1.4977
81 V A 0.0000
82 E A -1.4377
83 V A 0.0000
84 D A -1.9971
85 G A -2.1875

 

Laboratory of Theory of Biopolymers 2015