Project name: 10849eaa17f33ae

Status: done

Started: 2026-06-27 15:52:51
Settings
Chain sequence(s) A: KCNTATCATQRLANFLVRSSNNLGPVLPPTNVGSNTY
B: KCNTATCATQRLANFLVRSSNNLGPVLPPTNVGSNTY
input PDB
Selected Chain(s) A,B
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with all chain(s) selected           (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:42)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:43)
Show buried residues

Minimal score value
-1.9222
Maximal score value
2.3961
Average score
-0.3588
Total score value
-26.5523

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 K A -1.9145
2 C A -1.3517
3 N A -1.5272
4 T A -1.0821
5 A A -0.9581
6 T A -0.9405
7 C A -0.5310
8 A A -0.5992
9 T A -0.6228
10 Q A -1.0570
11 R A -1.1744
12 L A 0.6194
13 A A 0.0000
14 N A -0.5891
15 F A 0.9947
16 L A 0.7822
17 V A -0.7323
18 R A -1.4530
19 S A -0.9462
20 S A -1.2586
21 N A -1.8041
22 N A -1.7204
23 L A 0.3967
24 G A 0.3467
25 P A 0.9724
26 V A 2.3961
27 L A 2.0734
28 P A 0.5936
29 P A 0.0344
30 T A -0.3001
31 N A -0.6456
32 V A 0.8329
33 G A -0.4838
34 S A -0.7486
35 N A -1.5117
36 T A -0.1509
37 Y A 0.9654
1 K B -1.9140
2 C B -1.3555
3 N B -1.5289
4 T B -1.0784
5 A B -0.9559
6 T B -0.9490
7 C B -0.5690
8 A B -0.6062
9 T B -0.6171
10 Q B -1.1161
11 R B -1.1725
12 L B 0.6935
13 A B 0.0000
14 N B -0.5228
15 F B 1.0285
16 L B 0.7880
17 V B -0.7323
18 R B -1.4800
19 S B -0.9738
20 S B -1.2796
21 N B -1.9222
22 N B -1.8018
23 L B 0.2937
24 G B 0.2906
25 P B 0.9520
26 V B 2.3862
27 L B 2.0728
28 P B 0.5936
29 P B 0.0348
30 T B -0.2552
31 N B -0.6453
32 V B 0.8335
33 G B -0.3434
34 S B -0.7270
35 N B -1.5556
36 T B -0.2895
37 Y B 0.9666
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018