Project name: 47_rank

Status: done

Started: 2026-05-18 11:33:04
Settings
Chain sequence(s) B: STEGLTFHTPQEVIDFVMKEAGLHRHEVEYLLFQHPELTYTEKARYIVEQYAPP
input PDB
Selected Chain(s) B
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with B chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:56)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:57)
Show buried residues

Minimal score value
-3.2241
Maximal score value
1.1953
Average score
-1.1699
Total score value
-63.175

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 S B -1.2095
2 T B -1.6032
3 E B -2.0619
4 G B -1.0282
5 L B -0.3454
6 T B -0.4644
7 F B 0.0000
8 H B -1.2665
9 T B -1.2339
10 P B -1.4393
11 Q B -2.1619
12 E B -2.1907
13 V B 0.0000
14 I B -2.1241
15 D B -2.4451
16 F B -1.7366
17 V B 0.0000
18 M B -2.0945
19 K B -2.5937
20 E B -2.2320
21 A B 0.0000
22 G B -1.4796
23 L B -1.8001
24 H B -2.6228
25 R B -3.2241
26 H B -2.5874
27 E B -2.3680
28 V B 0.0000
29 E B -0.9094
30 Y B 0.2567
31 L B 0.0000
32 L B 0.0000
33 F B 1.1953
34 Q B -0.3692
35 H B -0.7189
36 P B -0.9542
37 E B -1.9657
38 L B -0.9829
39 T B -0.7873
40 Y B -0.5579
41 T B -0.9118
42 E B -1.3448
43 K B -0.7584
44 A B 0.0000
45 R B -2.1940
46 Y B -1.2131
47 I B 0.0000
48 V B -1.6381
49 E B -2.4939
50 Q B -1.7476
51 Y B -0.4532
52 A B -1.0684
53 P B -0.7806
54 P B -0.4647
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018