Project name: 10aeb6c2752f0e6

Status: done

Started: 2026-07-02 06:35:02
Settings
Chain sequence(s) A: MRVLYLLFSFLFIFLMPLPGVFGGIGDPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKPEAAKRVKVKSMSKGPGPGSVIPMLMSFGPGPGHLSFLTFSWAAYTPSIQAIVPLLVPEEGPGPGMWIFLLSNKLSGHSVGPGPGKGEVVVNGRIAYVPQGPGPGPEEELVKANSWNQFLQSGKKVSEYARKKLAATERTYGLRFKDQRVHVVSKSERVKMPKKKKEEDIRKLVTMYPDNITIAEERKKRLSFFTGFDSVEH
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:04:29)
[INFO]       Main:     Simulation completed successfully.                                          (00:04:31)
Show buried residues

Minimal score value
-4.9096
Maximal score value
5.8088
Average score
-0.0597
Total score value
-15.8216

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 M A 1.3815
2 R A 0.5371
3 V A 2.8483
4 L A 3.5207
5 Y A 3.5632
6 L A 3.5965
7 L A 4.4118
8 F A 5.3173
9 S A 4.7289
10 F A 5.3989
11 L A 5.4636
12 F A 5.8088
13 I A 5.7526
14 F A 5.4951
15 L A 4.6686
16 M A 3.5380
17 P A 2.3518
18 L A 2.7373
19 P A 0.9293
20 G A 0.9932
21 V A 2.5419
22 F A 2.5085
23 G A 0.7468
24 G A 0.0570
25 I A -0.0015
26 G A -0.7211
27 D A -0.5901
28 P A 0.4671
29 V A 1.3190
30 T A 0.0875
31 C A 0.0000
32 L A 1.1927
33 K A -0.5783
34 S A -0.2358
35 G A -0.6789
36 A A 0.0000
37 I A 0.5547
38 C A 0.9263
39 H A 0.4670
40 P A 1.0207
41 V A 2.1793
42 F A 1.9389
43 C A -0.2709
44 P A -1.3825
45 R A -2.8173
46 R A -3.4159
47 Y A -2.8146
48 K A -3.0300
49 Q A -1.7609
50 I A -0.7385
51 G A -0.9367
52 T A -0.8068
53 C A 0.0000
54 G A -0.3070
55 L A 0.7013
56 P A 0.2481
57 G A 0.3660
58 T A 0.4569
59 K A -0.1966
60 C A 0.0000
61 C A 0.0000
62 K A -2.2419
63 K A -3.3228
64 P A -2.6605
65 E A -2.6337
66 A A -1.8221
67 A A -1.6049
68 K A -2.6022
69 R A -2.0326
70 V A -0.1643
71 K A -1.3497
72 V A 0.4605
73 K A -0.9276
74 S A -0.5081
75 M A 0.1290
76 S A -0.9631
77 K A -1.8947
78 G A -1.5120
79 P A -1.2505
80 G A -1.1203
81 P A -0.6490
82 G A -0.2330
83 S A 0.8807
84 V A 2.5713
85 I A 3.0991
86 P A 2.2067
87 M A 2.6777
88 L A 2.8884
89 M A 2.3220
90 S A 1.6207
91 F A 1.8938
92 G A 0.3109
93 P A -0.3078
94 G A -0.8190
95 P A -0.9726
96 G A -0.8532
97 H A -0.4212
98 L A 1.4904
99 S A 1.5317
100 F A 3.0742
101 L A 3.1412
102 T A 2.2599
103 F A 2.8360
104 S A 1.5162
105 W A 1.8705
106 A A 1.1753
107 A A 0.9650
108 Y A 1.4581
109 T A 0.7131
110 P A 0.2865
111 S A 0.4210
112 I A 1.5195
113 Q A 0.4722
114 A A 1.4312
115 I A 2.9918
116 V A 3.0649
117 P A 2.5242
118 L A 3.3653
119 L A 3.0275
120 V A 2.1402
121 P A -0.2236
122 E A -2.4094
123 E A -2.9103
124 G A -2.0952
125 P A -1.3068
126 G A -0.9358
127 P A -0.0618
128 G A 0.6868
129 M A 2.1334
130 W A 3.2352
131 I A 4.2115
132 F A 4.0617
133 L A 3.2118
134 L A 2.7689
135 S A 1.2292
136 N A -0.7472
137 K A -1.1961
138 L A 0.2016
139 S A -0.7765
140 G A -0.9016
141 H A -0.6880
142 S A -0.1343
143 V A 0.9753
144 G A -0.0227
145 P A -0.5144
146 G A -0.9775
147 P A -1.1806
148 G A -2.0649
149 K A -2.2729
150 G A -1.4660
151 E A -0.4055
152 V A 1.4844
153 V A 2.0894
154 V A 1.2175
155 N A -0.6802
156 G A -0.6128
157 R A -0.6124
158 I A 1.6052
159 A A 1.7023
160 Y A 1.7151
161 V A 1.4210
162 P A -0.1791
163 Q A -1.4483
164 G A -1.1026
165 P A -1.0717
166 G A -1.0929
167 P A -1.6602
168 G A -1.6246
169 P A -1.6689
170 E A -2.4425
171 E A -2.3654
172 E A -2.5055
173 L A -0.3437
174 V A 0.0006
175 K A -1.8036
176 A A -1.1038
177 N A -1.2641
178 S A -0.2523
179 W A 0.2323
180 N A -1.2341
181 Q A -0.9405
182 F A 1.0634
183 L A 0.8727
184 Q A -0.9028
185 S A -0.8553
186 G A -1.3114
187 K A -1.9202
188 K A -2.1052
189 V A -0.2530
190 S A -1.0299
191 E A -2.3523
192 Y A -0.7715
193 A A -1.2275
194 R A -2.6541
195 K A -3.0539
196 K A -2.5681
197 L A -1.1543
198 A A -1.8374
199 A A -1.6690
200 T A -1.0750
201 E A -1.2864
202 R A -1.8943
203 T A -0.4259
204 Y A 0.4357
205 G A -0.2660
206 L A 0.4199
207 R A -1.3906
208 F A -0.7722
209 K A -2.5943
210 D A -3.2195
211 Q A -2.7153
212 R A -2.0516
213 V A 0.7930
214 H A 0.6061
215 V A 2.1648
216 V A 2.0110
217 S A -0.2524
218 K A -1.9235
219 S A -2.0169
220 E A -3.0163
221 R A -2.4964
222 V A -0.3613
223 K A -1.5697
224 M A -1.0526
225 P A -1.8172
226 K A -3.2691
227 K A -3.8508
228 K A -4.3173
229 K A -4.8636
230 E A -4.9096
231 E A -4.6708
232 D A -3.7982
233 I A -2.6200
234 R A -3.5351
235 K A -2.5796
236 L A -0.1278
237 V A 0.0418
238 T A -0.0477
239 M A 1.0108
240 Y A 1.0474
241 P A -0.2110
242 D A -1.8065
243 N A -1.3126
244 I A 0.5576
245 T A 0.5421
246 I A 1.6517
247 A A 0.1558
248 E A -2.6692
249 E A -4.0278
250 R A -4.6041
251 K A -4.3103
252 K A -3.8254
253 R A -2.7902
254 L A -0.1275
255 S A 0.9134
256 F A 2.9204
257 F A 3.3655
258 T A 1.4993
259 G A 0.9723
260 F A 1.3619
261 D A -0.7800
262 S A -0.3415
263 V A 0.3055
264 E A -1.7260
265 H A -1.4403
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018