Project name: obj1 [mutate: WN47C, TK58C]

Chain sequence(s)	C: EVQLVESGGGLVQPGGSLRLSCAASDFTFRSYEMSWVRQAPGKGLEWVSAISGSGGSTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAIYYCARLRDGFNKGFDYWGQGTLVTVSS
Selected Chain(s)	C
Distance of aggregation	10 Å
FoldX usage	Yes
Dynamic mode	No
Automated mutations	No
Mutated residues	WN47C,TK58C
Energy difference between WT (input) and mutated protein (by FoldX)	1.37021 kcal/mol CAUTION: Your mutation/s can destabilize the protein structure

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with C chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       FoldX:    Building mutant model                                                       (00:00:22)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:36)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:57)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:57)

• Minimal score value: -3.3169
• Maximal score value: 1.7651
• Average score: -0.7001
• Total score value: -84.0102

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
1	E	C	-2.0063
2	V	C	-0.9165
3	Q	C	-1.2443
4	L	C	0.0000
5	V	C	0.5648
6	E	C	0.2212
7	S	C	-0.4097
8	G	C	-0.8149
9	G	C	0.0110
10	G	C	0.9239
11	L	C	1.4406
12	V	C	-0.0385
13	Q	C	-1.3371
14	P	C	-1.4887
15	G	C	-1.4134
16	G	C	-0.9785
17	S	C	-1.2309
18	L	C	-0.9630
19	R	C	-2.1457
20	L	C	0.0000
21	S	C	-0.5415
22	C	C	0.0000
23	A	C	-0.2017
24	A	C	0.0000
25	S	C	-0.2017
26	D	C	0.0000
27	F	C	1.5458
28	T	C	0.2524
29	F	C	0.0000
30	R	C	-2.0212
31	S	C	-0.8870
32	Y	C	-1.2169
33	E	C	-1.2250
34	M	C	0.0000
35	S	C	0.0000
36	W	C	0.0000
37	V	C	0.0000
38	R	C	0.0000
39	Q	C	-0.5032
40	A	C	-0.9843
41	P	C	-1.2937
42	G	C	-1.4348
43	K	C	-2.1350
44	G	C	-1.0592
45	L	C	0.0116
46	E	C	-1.2044
47	N	C	-1.3354	mutated: WN47C
48	V	C	0.0000
49	S	C	0.0000
50	A	C	0.0000
51	I	C	0.0000
52	S	C	-0.7472
53	G	C	-1.2176
54	S	C	-1.1819
55	G	C	-1.2158
56	G	C	-0.9182
57	S	C	-0.6991
58	K	C	-0.6471	mutated: TK58C
59	Y	C	0.4482
60	Y	C	-0.6433
61	A	C	-1.4187
62	D	C	-2.2985
63	S	C	-1.7072
64	V	C	0.0000
65	K	C	-2.3278
66	G	C	-1.6106
67	R	C	0.0000
68	F	C	0.0000
69	T	C	-0.7708
70	I	C	0.0000
71	S	C	-0.6945
72	R	C	-1.3348
73	D	C	-1.9655
74	N	C	-2.1777
75	S	C	-1.7905
76	K	C	-2.3163
77	N	C	-1.6491
78	T	C	0.0000
79	L	C	0.0000
80	Y	C	-0.6678
81	L	C	0.0000
82	Q	C	-1.2319
83	M	C	0.0000
84	N	C	-1.3321
85	S	C	-1.2322
86	L	C	0.0000
87	R	C	-2.4721
88	A	C	-1.8894
89	E	C	-2.3444
90	D	C	0.0000
91	T	C	-0.4216
92	A	C	0.0000
93	I	C	1.0770
94	Y	C	0.0000
95	Y	C	0.4632
96	C	C	0.0000
97	A	C	0.0000
98	R	C	0.0000
99	L	C	0.0000
100	R	C	-3.1749
101	D	C	-3.3169
102	G	C	-2.0539
103	F	C	-1.1294
104	N	C	-2.3967
105	K	C	-3.1645
106	G	C	-1.8865
107	F	C	-0.9600
108	D	C	-1.0907
109	Y	C	-0.2053
110	W	C	0.5597
111	G	C	-0.0702
112	Q	C	-0.8792
113	G	C	0.1067
114	T	C	0.5812
115	L	C	1.7651
116	V	C	0.0000
117	T	C	0.3369
118	V	C	0.0000
119	S	C	-0.7749
120	S	C	-1.0602