Project name: gp63_004

Status: done

Started: 2026-04-27 15:03:44
Settings
Chain sequence(s) H: QVQLVESGGGLVQPGGSLRLSCAASGDSTFDFSKLSLGWFRQAPGQGLEAVAAIDSDGTKTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAARYSRNIPSLVPSSFEYWGQGTLVTVS
input PDB
Selected Chain(s) H
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with H chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:01)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:02:15)
[INFO]       Main:     Simulation completed successfully.                                          (00:02:16)
Show buried residues

Minimal score value
-3.0223
Maximal score value
1.8318
Average score
-0.7073
Total score value
-89.8322

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 Q H -2.0331
2 V H 0.0000
3 Q H -1.4434
4 L H 0.0000
5 V H 1.1431
6 E H 0.0000
7 S H -0.2129
8 G H -0.8117
9 G H 0.0970
10 G H 0.6773
11 L H 1.4327
12 V H -0.0885
13 Q H -1.4073
14 P H -1.8547
15 G H -1.6875
16 G H -1.2063
17 S H -1.6408
18 L H -1.1262
19 R H -2.4033
20 L H 0.0000
21 S H -0.4875
22 C H 0.0000
23 A H -0.1247
24 A H 0.0000
25 S H -1.4320
26 G H -2.1905
27 D H -2.5989
28 S H -1.4511
29 T H -1.0936
30 F H -1.6123
31 D H -1.8184
32 F H 0.0000
33 S H -2.3244
34 K H -2.9909
35 L H 0.0000
36 S H 0.0000
37 L H 0.0000
38 G H 0.0000
39 W H 0.0000
40 F H 0.0000
41 R H 0.0000
42 Q H -0.7329
43 A H -1.0010
44 P H -0.9276
45 G H -1.2986
46 Q H -1.8336
47 G H -1.2104
48 L H -0.2470
49 E H -0.5682
50 A H 0.1715
51 V H 0.0000
52 A H 0.0000
53 A H 0.0000
54 I H 0.0000
55 D H 0.0000
56 S H -2.2915
57 D H -2.8818
58 G H -1.7654
59 T H -1.4554
60 K H -1.5557
61 T H 0.0849
62 Y H 0.8893
63 Y H -0.1422
64 A H -1.0435
65 D H -2.3241
66 S H -1.8262
67 V H 0.0000
68 K H -2.4718
69 G H -1.9214
70 R H -1.9646
71 F H 0.0000
72 T H -1.0263
73 I H 0.0000
74 S H -0.9356
75 R H -1.3930
76 D H -2.0304
77 N H -2.3183
78 S H -1.6214
79 K H -2.3846
80 N H -1.8433
81 T H -1.0239
82 L H 0.0000
83 Y H 0.0000
84 L H 0.0000
85 Q H -1.8268
86 M H 0.0000
87 N H -2.3437
88 S H -1.7490
89 L H 0.0000
90 R H -3.0223
91 A H -2.0461
92 E H -2.4560
93 D H 0.0000
94 T H -0.5484
95 A H 0.0000
96 V H 0.7437
97 Y H 0.0000
98 Y H 0.3381
99 C H 0.0000
100 A H 0.0000
101 A H 0.0000
102 R H -1.3170
103 Y H -1.0088
104 S H -1.3046
105 R H -2.4456
106 N H -1.7620
107 I H 0.5680
108 P H 0.5937
109 S H 1.2819
110 L H 1.6514
111 V H 1.8318
112 P H 0.6089
113 S H -0.0207
114 S H -0.0056
115 F H 0.0000
116 E H -1.7454
117 Y H -0.9814
118 W H -0.2388
119 G H -0.0755
120 Q H -0.6823
121 G H 0.1043
122 T H 0.6182
123 L H 1.5780
124 V H 0.0000
125 T H 0.2856
126 V H 0.0000
127 S H -0.8719
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018