Project name: 11632146a21631e

Status: done

Started: 2026-04-29 21:02:32
Settings
Chain sequence(s) A: SNAQVQLVESGGGLVQPGGSLRLSCAASGRTFSSYSMGWFRQAPGKEREFVAAISKGGYKYDAVSLEGRFTISRDNSKNTVYLQMNSLRPEDTAVYYCASSRAYGSSRLRLADTYEYWGQGTLVTVSSAEAAAKEAAAKEAAAKAGC
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:01)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:21)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:22)
Show buried residues

Minimal score value
-3.6494
Maximal score value
1.7116
Average score
-0.9149
Total score value
-134.4874

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 S A -0.9650
2 N A -1.8389
3 A A -1.5666
4 Q A -1.8066
5 V A -1.2436
6 Q A -0.7520
7 L A 0.0000
8 V A 1.1538
9 E A 0.3563
10 S A -0.1326
11 G A -0.7265
12 G A 0.0855
13 G A 0.5942
14 L A 1.3957
15 V A 0.2497
16 Q A -0.5299
17 P A -1.3374
18 G A -1.2924
19 G A -0.7361
20 S A -1.1644
21 L A -0.9424
22 R A -2.1372
23 L A 0.0000
24 S A -0.4118
25 C A 0.0000
26 A A -0.1546
27 A A -0.5713
28 S A -0.9328
29 G A -1.6469
30 R A -2.2295
31 T A -1.2264
32 F A 0.0000
33 S A -1.3582
34 S A -1.2736
35 Y A 0.0000
36 S A 0.0000
37 M A 0.0000
38 G A 0.0000
39 W A 0.0000
40 F A 0.0000
41 R A -1.1487
42 Q A -1.9110
43 A A -1.7209
44 P A -1.3848
45 G A -1.9432
46 K A -3.4003
47 E A -3.6494
48 R A -2.9223
49 E A -2.5346
50 F A 0.0000
51 V A 0.0000
52 A A 0.0000
53 A A 0.0000
54 I A 0.0000
55 S A 0.0000
56 K A -1.5450
57 G A -0.7605
58 G A -0.5411
59 Y A 0.1790
60 K A -1.1412
61 Y A -0.9984
62 D A -1.5366
63 A A -0.5567
64 V A 0.7845
65 S A -0.1199
66 L A 0.0000
67 E A -1.8179
68 G A -1.5275
69 R A -1.5799
70 F A 0.0000
71 T A -1.2606
72 I A 0.0000
73 S A -0.5833
74 R A -1.2960
75 D A -1.8650
76 N A -2.2889
77 S A -1.8522
78 K A -2.5360
79 N A -2.2009
80 T A 0.0000
81 V A 0.0000
82 Y A -0.6516
83 L A 0.0000
84 Q A -1.3040
85 M A 0.0000
86 N A -1.5639
87 S A -1.3102
88 L A 0.0000
89 R A -2.6777
90 P A -1.9593
91 E A -2.4544
92 D A 0.0000
93 T A -0.5363
94 A A 0.0000
95 V A 0.6829
96 Y A 0.0000
97 Y A 0.0161
98 C A 0.0000
99 A A 0.0000
100 S A 0.0000
101 S A 0.0000
102 R A -2.0038
103 A A -1.1375
104 Y A 0.0694
105 G A -0.4485
106 S A -0.9571
107 S A -1.3916
108 R A -2.3010
109 L A 0.0000
110 R A -2.5130
111 L A -1.1478
112 A A -1.5591
113 D A -2.2437
114 T A -1.8438
115 Y A 0.0000
116 E A -2.1445
117 Y A -0.7736
118 W A -0.0724
119 G A -0.0518
120 Q A -0.8592
121 G A 0.0616
122 T A 0.6122
123 L A 1.7116
124 V A 0.0000
125 T A 0.4034
126 V A 0.0000
127 S A -0.4904
128 S A -0.5562
129 A A -0.5596
130 E A -0.7159
131 A A -1.2089
132 A A -1.1519
133 A A -1.5073
134 K A -2.9484
135 E A -3.2451
136 A A -2.3432
137 A A -2.1867
138 A A -2.5060
139 K A -3.3989
140 E A -3.3757
141 A A -2.0774
142 A A -1.5645
143 A A -1.7553
144 K A -2.2151
145 A A -0.9544
146 G A -0.5906
147 C A 0.0135
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018