Project name: 116c2d6d8cf168d

Chain sequence(s)	A: MDVFMKGLSMAKEGVVAAAEKTKQGVTEAAEKTKEGVLYVGSKTREGVVQGVASVAEKTKEQASHLGGAVFSGAGNIAAATGLVKREEFPTDLKPEEVAQEAAEEPLIEPLMEPEGESYEDPPQEEYQEYEPEA
Selected Chain(s)	A
Distance of aggregation	10 Å
FoldX usage	Yes
Dynamic mode	No
Automated mutations	No

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:01)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:04:46)
[INFO]       Main:     Simulation completed successfully.                                          (00:04:48)

• Minimal score value: -3.6741
• Maximal score value: 2.5457
• Average score: -0.8859
• Total score value: -118.7056

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
1	M	A	1.2265
2	D	A	0.0213
3	V	A	1.8206
4	F	A	2.5457
5	M	A	1.3246
6	K	A	-0.2552
7	G	A	0.3912
8	L	A	0.3628
9	S	A	-0.2220
10	M	A	0.1723
11	A	A	-0.2845
12	K	A	-1.3416
13	E	A	-1.2298
14	G	A	-0.2387
15	V	A	0.9834
16	V	A	0.7432
17	A	A	-0.7237
18	A	A	-0.8462
19	A	A	-1.1697
20	E	A	-2.8881
21	K	A	-2.9324
22	T	A	-2.2524
23	K	A	-3.1974
24	Q	A	-3.0485
25	G	A	-1.9382
26	V	A	-0.2376
27	T	A	-1.4842
28	E	A	-2.7361
29	A	A	-1.7899
30	A	A	-2.1391
31	E	A	-3.6741
32	K	A	-3.6725
33	T	A	-2.1692
34	K	A	-2.3972
35	E	A	-2.0115
36	G	A	-0.0324
37	V	A	1.7006
38	L	A	1.9515
39	Y	A	1.9309
40	V	A	1.8763
41	G	A	0.6554
42	S	A	-0.2641
43	K	A	-1.2261
44	T	A	-1.0154
45	R	A	-2.1339
46	E	A	-2.4093
47	G	A	-1.2160
48	V	A	1.1646
49	V	A	1.2876
50	Q	A	-0.0271
51	G	A	0.9702
52	V	A	2.4368
53	A	A	1.0591
54	S	A	0.4615
55	V	A	1.0669
56	A	A	-0.6993
57	E	A	-2.4881
58	K	A	-2.3723
59	T	A	-2.0092
60	K	A	-3.4774
61	E	A	-3.5221
62	Q	A	-2.4581
63	A	A	-1.3531
64	S	A	-1.6290
65	H	A	-1.6824
66	L	A	0.0412
67	G	A	0.1797
68	G	A	0.3231
69	A	A	1.1055
70	V	A	2.4149
71	F	A	2.1830
72	S	A	0.7853
73	G	A	0.5772
74	A	A	0.8097
75	G	A	0.1379
76	N	A	-0.3961
77	I	A	1.1443
78	A	A	1.0107
79	A	A	0.5755
80	A	A	0.4444
81	T	A	0.8503
82	G	A	0.7381
83	L	A	1.4006
84	V	A	0.6906
85	K	A	-2.1485
86	R	A	-2.9685
87	E	A	-3.3019
88	E	A	-2.7535
89	F	A	-0.1065
90	P	A	-0.6404
91	T	A	-0.5790
92	D	A	-1.4433
93	L	A	-0.5660
94	K	A	-2.3270
95	P	A	-1.8140
96	E	A	-2.8037
97	E	A	-2.7286
98	V	A	-0.7560
99	A	A	-1.2730
100	Q	A	-2.6231
101	E	A	-2.9159
102	A	A	-1.8628
103	A	A	-2.2013
104	E	A	-3.3038
105	E	A	-2.3940
106	P	A	-0.5981
107	L	A	1.0839
108	I	A	1.6900
109	E	A	0.0657
110	P	A	0.2986
111	L	A	1.2548
112	M	A	0.2877
113	E	A	-1.6611
114	P	A	-2.0051
115	E	A	-3.0785
116	G	A	-2.4411
117	E	A	-2.6379
118	S	A	-1.5976
119	Y	A	-0.6305
120	E	A	-2.4345
121	D	A	-2.7705
122	P	A	-2.1871
123	P	A	-2.5415
124	Q	A	-2.9138
125	E	A	-3.1810
126	E	A	-3.1417
127	Y	A	-1.1867
128	Q	A	-2.1999
129	E	A	-2.2712
130	Y	A	-0.9225
131	E	A	-2.4892
132	P	A	-1.8754
133	E	A	-2.2343
134	A	A	-1.1501