Project name: Rat IAPP_2

Status: done

Started: 2026-06-25 07:37:25
Settings
Chain sequence(s) A: KCNTATCATQRLANFLVRSSNNLGPVLPPTNVGSNTY
B: KCNTATCATQRLANFLVRSSNNLGPVLPPTNVGSNTY
input PDB
Selected Chain(s) A,B
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with all chain(s) selected           (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:42)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:42)
Show buried residues

Minimal score value
-2.0626
Maximal score value
1.0081
Average score
-0.7213
Total score value
-53.3765

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 K A -1.7140
2 C A -0.8497
3 N A -1.4361
4 T A -1.0190
5 A A 0.0000
6 T A -0.8898
7 C A -1.0949
8 A A -1.2345
9 T A 0.0000
10 Q A -1.8129
11 R A -2.0307
12 L A -0.7536
13 A A 0.0000
14 N A -1.5445
15 F A 0.2497
16 L A 0.0000
17 V A -0.9988
18 R A -1.8823
19 S A -1.0011
20 S A 0.0000
21 N A -2.0626
22 N A -1.6375
23 L A 0.2463
24 G A -0.5962
25 P A -1.1640
26 V A 0.0000
27 L A 0.0000
28 P A -0.4253
29 P A -0.4270
30 T A -0.3188
31 N A -0.8694
32 V A 0.6058
33 G A -0.6372
34 S A -0.8533
35 N A -1.1479
36 T A -0.2318
37 Y A 1.0081
1 K B -1.7145
2 C B -0.8405
3 N B -1.4299
4 T B -0.9976
5 A B -1.1604
6 T B -0.8909
7 C B -1.0722
8 A B -1.3467
9 T B 0.0000
10 Q B -1.7909
11 R B -1.9964
12 L B -0.7211
13 A B 0.0000
14 N B -1.4777
15 F B 0.1664
16 L B 0.0000
17 V B -0.9759
18 R B -1.8706
19 S B -1.0058
20 S B 0.0000
21 N B -1.8850
22 N B -1.6515
23 L B 0.2338
24 G B -0.6230
25 P B -1.1685
26 V B 0.0000
27 L B 0.0000
28 P B -0.3906
29 P B -0.3882
30 T B -0.3080
31 N B -0.7121
32 V B 0.5474
33 G B -0.5783
34 S B -0.5967
35 N B -0.6590
36 T B -0.2240
37 Y B 0.6749
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018