Project name: 12571baab935547 [mutate: VR22B]

Status: done

Started: 2026-07-06 12:22:17
Settings
Chain sequence(s) B: KRKLSKDEQENYKKVLESKKDVEKALEEAGGKDVSKLTPYWQIVKEEVEMALKYFEEKLK
input PDB
Selected Chain(s) B
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Mutated residues VR22B
Energy difference between WT (input) and mutated protein (by FoldX) 4.30497 kcal/mol

CAUTION: Your mutation/s can destabilize the protein structure

Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with B chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:01)
[INFO]       FoldX:    Building mutant model                                                       (00:01:51)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:01:57)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:03:09)
[INFO]       Main:     Simulation completed successfully.                                          (00:03:09)
Show buried residues

Minimal score value
-4.7216
Maximal score value
1.5991
Average score
-2.4437
Total score value
-146.623

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 K B -3.9422
2 R B -4.2944
3 K B -3.4661
4 L B 0.0000
5 S B -2.8210
6 K B -3.6797
7 D B -4.0225
8 E B -3.6798
9 Q B -4.0662
10 E B -4.1810
11 N B -3.6212
12 Y B -2.7614
13 K B -3.8338
14 K B -3.8468
15 V B 0.0000
16 L B -2.6109
17 E B -4.0046
18 S B -3.6451
19 K B -3.9858
20 K B -4.4202
21 D B -4.3938
22 R B -3.9159 mutated: VR22B
23 E B -4.4434
24 K B -4.7216
25 A B 0.0000
26 L B 0.0000
27 E B -4.5805
28 E B -3.8995
29 A B -3.1238
30 G B -2.6535
31 G B -3.2143
32 K B -3.7860
33 D B -3.1510
34 V B -1.6138
35 S B -1.6179
36 K B -2.7590
37 L B 0.0000
38 T B 0.1307
39 P B 0.5695
40 Y B 1.5991
41 W B 0.2946
42 Q B -0.0363
43 I B 0.9472
44 V B -0.6212
45 K B -1.9486
46 E B -2.5746
47 E B -2.7652
48 V B 0.0000
49 E B -2.4554
50 M B -1.4861
51 A B -1.2035
52 L B -1.6012
53 K B -1.6936
54 Y B -0.2839
55 F B -1.5509
56 E B -3.1241
57 E B -3.5363
58 K B -3.1148
59 L B -3.6156
60 K B -3.7961
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018