Project name: RiAFP

Chain sequence(s)	A: GYSCRAVGVDGRAVTDIQGTCHAKATGAGAMASGTSEPGSTSTATATGRGATARSTSTGRGTATTTATGTASATSNAIGQGTATTTATGSAGGRATGSATTSSSASQPTQTQTITGPGFQTAKSFARNTATTTVTASHHHHHH
Selected Chain(s)	A
Distance of aggregation	10 Å
FoldX usage	Yes
Dynamic mode	No
Automated mutations	No

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:01)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:08)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:09)

• Minimal score value: -2.4693
• Maximal score value: 1.1796
• Average score: -0.5923
• Total score value: -84.6957

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
1	G	A	-0.9469
2	Y	A	-0.4208
3	S	A	-0.7473
4	C	A	0.0000
5	R	A	-1.7626
6	A	A	0.0000
7	V	A	1.1796
8	G	A	-0.1742
9	V	A	-0.2315
10	D	A	-2.3155
11	G	A	-1.9798
12	R	A	-2.2357
13	A	A	-0.9569
14	V	A	-0.4168
15	T	A	-0.4056
16	D	A	-0.3481
17	I	A	0.6693
18	Q	A	-0.5412
19	G	A	-0.6840
20	T	A	-0.5183
21	C	A	0.0000
22	H	A	-0.4688
23	A	A	0.0000
24	K	A	-0.8798
25	A	A	0.0000
26	T	A	-0.9623
27	G	A	-1.3098
28	A	A	-0.9640
29	G	A	-1.1035
30	A	A	0.0000
31	M	A	-0.1358
32	A	A	0.0000
33	S	A	-1.2538
34	G	A	0.0000
35	T	A	-0.8708
36	S	A	0.0000
37	E	A	-1.6155
38	P	A	-1.3186
39	G	A	-1.6323
40	S	A	0.0000
41	T	A	-0.7916
42	S	A	0.0000
43	T	A	-0.2286
44	A	A	0.0000
45	T	A	-0.7408
46	A	A	0.0000
47	T	A	-0.8080
48	G	A	-1.3703
49	R	A	-2.3225
50	G	A	-1.5504
51	A	A	0.0000
52	T	A	-0.4366
53	A	A	0.0000
54	R	A	-1.1992
55	S	A	0.0000
56	T	A	-0.2550
57	S	A	0.0000
58	T	A	-0.7722
59	G	A	-1.2731
60	R	A	-2.2059
61	G	A	0.0000
62	T	A	-0.6419
63	A	A	0.0000
64	T	A	-0.2805
65	T	A	0.0000
66	T	A	-0.3209
67	A	A	0.0000
68	T	A	-0.5008
69	G	A	-1.2278
70	T	A	-1.2722
71	A	A	0.0000
72	S	A	-0.5675
73	A	A	0.0000
74	T	A	-0.6822
75	S	A	0.0000
76	N	A	0.0150
77	A	A	0.0000
78	I	A	0.4710
79	G	A	-0.5970
80	Q	A	-1.2495
81	G	A	-1.2627
82	T	A	-0.7487
83	A	A	0.0000
84	T	A	-0.1261
85	T	A	0.0000
86	T	A	-0.0959
87	A	A	0.0000
88	T	A	-0.4863
89	G	A	0.0000
90	S	A	-1.0733
91	A	A	-1.0830
92	G	A	-1.4018
93	G	A	0.0000
94	R	A	-1.5467
95	A	A	0.0000
96	T	A	-0.4562
97	G	A	0.0000
98	S	A	-0.7486
99	A	A	0.0000
100	T	A	0.0044
101	T	A	0.0000
102	S	A	-0.3541
103	S	A	-0.8623
104	S	A	-0.3993
105	A	A	0.0000
106	S	A	-0.6752
107	Q	A	-1.2827
108	P	A	-1.2902
109	T	A	-0.9043
110	Q	A	-0.8930
111	T	A	-0.5939
112	Q	A	-0.8449
113	T	A	-0.3350
114	I	A	0.1429
115	T	A	0.2785
116	G	A	-0.3523
117	P	A	-1.1956
118	G	A	0.0000
119	F	A	0.5853
120	Q	A	0.3001
121	T	A	-0.2904
122	A	A	0.0000
123	K	A	-1.5849
124	S	A	0.0000
125	F	A	0.1972
126	A	A	0.0000
127	R	A	-1.4757
128	N	A	-1.8141
129	T	A	-0.9244
130	A	A	0.0000
131	T	A	-0.5059
132	T	A	0.0000
133	T	A	-0.3539
134	V	A	0.0000
135	T	A	-0.0830
136	A	A	0.0000
137	S	A	-1.2032
138	H	A	-2.0191
139	H	A	-2.2658
140	H	A	-1.9727
141	H	A	-2.4693
142	H	A	-2.2702
143	H	A	-1.7996